Cdk9 Antibody (2D7)

Images

 
Western Blot: Cdk9 Antibody (2D7) [H00001025-M07] - Analysis of CDK9 expression in transfected 293T cell line by CDK9 monoclonal antibody (M07), clone 2D7. Lane 1: CDK9 transfected lysatE (42.778 KDa). Lane 2: ...read more
Immunocytochemistry/ Immunofluorescence: Cdk9 Antibody (2D7) [H00001025-M07] - Analysis of monoclonal antibody to CDK9 on HeLa cell. Antibody concentration 10 ug/ml
Sandwich ELISA: Cdk9 Antibody (2D7) [H00001025-M07] - Detection limit for recombinant GST tagged CDK9 is approximately 1ng/ml as a capture antibody.

Product Details

Summary
Reactivity Hu, DrSpecies Glossary
Applications WB, ELISA, ICC/IF, IP
Clone
2D7
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Cdk9 Antibody (2D7) Summary

Immunogen
CDK9 (AAH01968 271 a.a. - 372 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. QKRKVKDRLKAYVRDPYALDLIDKLLVLDPAQRIDSDDALNHDFFWSDPMPSDLKGMLSTHLTSMFEYLAPPRRKGSQITQQSTNQSRNPATTNQTEFERVF
Specificity
CDK9 - cyclin-dependent kinase 9 (CDC2-related kinase) (2D7)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
CDK9
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Immunoprecipitation
Application Notes
Antibody reactivity against transfected lysate and recombinant protein for WB. It has been used for ELISA.Use in immunoprecipitation reported in scientific literature (PMID 28754981).
Publications
Read Publication using
H00001025-M07 in the following applications:

  • IP
    1 publication

Reactivity Notes

Drosophila reactivity reported in scientific literature (PMID: 28754981).

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Cdk9 Antibody (2D7)

  • C-2k
  • CDC2L4CTK1
  • CDC2-related kinase
  • Cell division cycle 2-like protein kinase 4
  • Cell division protein kinase 9
  • cyclin-dependent kinase 9 (CDC2-related kinase)
  • cyclin-dependent kinase 9
  • EC 2.7.11
  • EC 2.7.11.22
  • EC 2.7.11.23
  • PITALRE
  • serine/threonine protein kinase PITALRE
  • Serine/threonine-protein kinase PITALRE
  • TAK

Background

The protein encoded by this gene is a member of the cyclin-dependent protein kinase (CDK) family. CDK family members are highly similar to the gene products of S. cerevisiae cdc28, and S. pombe cdc2, and known as important cell cycle regulators. This kinase was found to be a component of the multiprotein complex TAK/P-TEFb, which is an elongation factor for RNA polymerase II-directed transcription and functions by phosphorylating the C-terminal domain of the largest subunit of RNA polymerase II. This protein forms a complex with and is regulated by its regulatory subunit cyclin T or cyclin K. HIV-1 Tat protein was found to interact with this protein and cyclin T, which suggested a possible involvement of this protein in AIDS. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00000904-Q01
Species: Hu
NBP2-48990
Species: Hu
Applications: ICC/IF, IHC
46420002
Species: Hu
Applications: WB, ELISA
NBP2-37507
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
NB100-581
Species: Hu
Applications: WB, IHC, IP, PLA
NBP1-87592
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-85729
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88376
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-71867
Species: Hu, Mu
Applications: WB, IHC-P, IP
NBP1-06519
Species: Hu
Applications: WB, IHC-P, IP
H00001024-M03
Species: Hu, Mu, Rt
Applications: WB, ELISA
NB500-106
Species: Hu, Mu, Rt, Po, Ch, Dr, Fi, Pm, Rb, Ye, Ze
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
NBP2-15843
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-31541
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-29323
Species: Hu, Mu, Rt, Bv, Ca, Ch, Xp
NBP1-31308
Species: Hu, Mu, Rt, Bv
Applications: WB, ICC/IF, IHC, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC

Publications for Cdk9 Antibody (H00001025-M07)(1)

We have publications tested in 1 confirmed species: Drosophila.

We have publications tested in 1 application: IP.


Filter By Application
IP
(1)
All Applications
Filter By Species
Drosophila
(1)
All Species

Reviews for Cdk9 Antibody (H00001025-M07) (0)

There are no reviews for Cdk9 Antibody (H00001025-M07). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Cdk9 Antibody (H00001025-M07) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Cdk9 Products

Bioinformatics Tool for Cdk9 Antibody (H00001025-M07)

Discover related pathways, diseases and genes to Cdk9 Antibody (H00001025-M07). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Cdk9 Antibody (H00001025-M07)

Discover more about diseases related to Cdk9 Antibody (H00001025-M07).
 

Pathways for Cdk9 Antibody (H00001025-M07)

View related products by pathway.

PTMs for Cdk9 Antibody (H00001025-M07)

Learn more about PTMs related to Cdk9 Antibody (H00001025-M07).
 

Research Areas for Cdk9 Antibody (H00001025-M07)

Find related products by research area.

Blogs on Cdk9

There are no specific blogs for Cdk9, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Cdk9 Antibody (2D7) and receive a gift card or discount.

Bioinformatics

Gene Symbol CDK9
Entrez
Uniprot