CDIP Antibody

Images

 
Western Blot: CDIP Antibody [H00029965-B01P] - Analysis of C16orf5 expression in transfected 293T cell line by C16orf5 polyclonal antibody. Lane 1: C16orf5 transfected lysate(22.88 KDa). Lane 2: Non-transfected lysate.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

CDIP Antibody Summary

Immunogen
C16orf5 (AAH02882, 1 a.a. - 208 a.a.) full-length human protein. MSSEPPPPYPGGPTAPLLEEKSGAPPTPGRSSPAVMQPPPGMPLPPADIGPPPYEPPGHPMPQPGFIPPHMSADGTYMPPGFYPPPGPHPPMGYYPPGPYTPGPYPGPGGHTATVLVPSGAATTVTVLQGEIFEGAPVQTVCPHCQQAITTKISYEIGLMNFVLGFFCCFMGCDLGCCLIPCLINDFKDVTHTCPSCKAYIYTYKRLC
Specificity
C16orf5 - chromosome 16 open reading frame 5,
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
CDIP1
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:500
Application Notes
Antibody reactive against Recombinant Protein with GST tag on ELISA and Western Blot and also on transfected lysate in western blot. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for CDIP Antibody

  • CDIP
  • cell death inducing protein
  • Cell death-inducing protein
  • chromosome 16 open reading frame 5
  • I1
  • LITAF-like protein
  • Transmembrane protein I1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF9024
Species: Mu, Rt
Applications: IHC, WB
NBP2-13961
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-54301
Species: Hu, Mu, Rt
Applications: CyTOF-ready, ELISA, IHC, IHC-P, WB
NBP1-89522
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
MAB1417
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
NBP1-32870
Species: Ch, Hu
Applications: IHC, IHC-P, IP, KD, WB
AF1513
Species: Mu
Applications: CyTOF-ready, Flow, IHC, IP, Simple Western, WB
NBP1-81630
Species: Hu
Applications: IHC, IHC-P
NBP2-34390
Species: Hu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-P, WB
664-LI/CF
Species: Hu
Applications: BA
NBP2-67150
Species: Hu, Mu, Rt
Applications: IHC, IHC-Fr, IHC-P, IP, WB
NBP2-67656
Species: Hu, Mu, Rt, Ze
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
MAB5018
Species: Hu
Applications: IP, WB
NBP1-78977
Species: Hu, Mu, Rt
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-P, IM, IP, Simple Western, WB
NBP1-00178
Species: Hu, Mu, Sh
Applications: Flow, ICC/IF, IHC, IHC-Fr, PEP-ELISA, WB
NBP3-17255
Species: Hu
Applications: ICC/IF, WB
NBP1-59069
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-38449
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00029965-B01P
Species: Hu
Applications: WB

Publications for CDIP Antibody (H00029965-B01P) (0)

There are no publications for CDIP Antibody (H00029965-B01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CDIP Antibody (H00029965-B01P) (0)

There are no reviews for CDIP Antibody (H00029965-B01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CDIP Antibody (H00029965-B01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CDIP Products

Bioinformatics Tool for CDIP Antibody (H00029965-B01P)

Discover related pathways, diseases and genes to CDIP Antibody (H00029965-B01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CDIP Antibody (H00029965-B01P)

Discover more about diseases related to CDIP Antibody (H00029965-B01P).

Research Areas for CDIP Antibody (H00029965-B01P)

Find related products by research area.

Blogs on CDIP

There are no specific blogs for CDIP, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CDIP Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CDIP1
Entrez
Uniprot