CDC73/HRPT2 Antibody Summary
Immunogen |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: ADEVLAEAKKPRIEDEECVRLDKERLAARLEGHKEGIVQTEQIRSLSEAMSVEKIAAIKAKIMAKKRSTIKTDLDDDITALKQRSFVDAEVDVTRDIVSRERVWRTRTTILQSTGKNFSKNIFAILQSVKAREEGRAPEQRPAPNAAPVD |
Predicted Species |
Mouse (100%), Rat (100%). Backed by our 100% Guarantee. |
Isotype |
IgG |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
CDC73 |
Purity |
Affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
|
Application Notes |
ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
Control Peptide |
|
Packaging, Storage & Formulations
Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer |
PBS (pH 7.2) and 40% Glycerol |
Preservative |
0.02% Sodium Azide |
Purity |
Affinity purified |
Alternate Names for CDC73/HRPT2 Antibody
Background
Parafibromin, the product of gene HPRT2, acts as a tumor suppressor protein by inhibiting cell proliferation and blocking expression of cyclin D1 when overexpressed. Parafibromin has also been shown to bind with the PAF1 complex / RNA polymerase II which is involved with transcription elongation and the RNA processing pathway.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu
Applications: IP, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu, Mu
Applications: IHC, IHC-P, IP, Simple Western, WB
Species: Bv, Hu, Mu, Po, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, WB
Species: Hu, Mu
Applications: IHC, IHC-P, IP, WB
Species: Hu, Mu
Applications: IHC, IHC-P, IP, WB
Species: Mu
Applications: IHC, WB
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: IHC, IHC-P, IP, WB
Species: Hu
Applications: WB
Species: Ce, Dr, Hu, In, Ma, Mu, Po, Rt, Ye
Applications: ChIP, ELISA, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu
Applications: ELISA, IHC, IHC-Fr, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Publications for CDC73/HRPT2 Antibody (NBP2-55257) (0)
There are no publications for CDC73/HRPT2 Antibody (NBP2-55257).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for CDC73/HRPT2 Antibody (NBP2-55257) (0)
There are no reviews for CDC73/HRPT2 Antibody (NBP2-55257).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for CDC73/HRPT2 Antibody (NBP2-55257) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional CDC73/HRPT2 Products
Bioinformatics Tool for CDC73/HRPT2 Antibody (NBP2-55257)
Discover related pathways, diseases and genes to CDC73/HRPT2 Antibody (NBP2-55257). Need help?
Read the
Bioinformatics Tool Guide for instructions on using this tool.
Diseases for CDC73/HRPT2 Antibody (NBP2-55257)
Discover more about diseases related to CDC73/HRPT2 Antibody (NBP2-55257).
| | Pathways for CDC73/HRPT2 Antibody (NBP2-55257)
View related products by pathway.
|
PTMs for CDC73/HRPT2 Antibody (NBP2-55257)
Learn more about PTMs related to CDC73/HRPT2 Antibody (NBP2-55257).
| | Research Areas for CDC73/HRPT2 Antibody (NBP2-55257)
Find related products by research area.
|
Blogs on CDC73/HRPT2