Cdc27 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: Cdc27 Antibody [NBP2-56172] - Staining of human cell line U-251 MG shows localization to nucleoplasm.

• Reactivity: Hu, Mu, Rt
• Applications: ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Cdc27 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Cdc27 Antibody - BSA Free (NBP2-56172) is a polyclonal antibody validated for use in ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: AIWQALNHYAYRDAVFLAERLYAEVHSEEALFLLATCYYRSGKAYKAYRLLKGHSCTTPQCKYLLAKCCVDLSKLAEGEQILSGGVFNKQKS
• Predicted Species: Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CDC27
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
• Application Notes: ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  Cdc27 Recombinant Protein Antigen (NBP2-56172PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Cdc27 Antibody - BSA Free

• ANAPC3CDC27 homolog
• anaphase promoting complex subunit 3
• Anaphase-promoting complex subunit 3
• anaphase-promoting complex, protein 3
• APC 3
• APC3cell division cycle 27
• CDC27Hs
• cell division cycle 27 homolog (S. cerevisiae)
• cell division cycle protein 27 homolog
• D0S1430E
• D17S978E
• HNUC
• H-NUC
• nuc2 homolog
• NUC2

Background

Cdc27 shares strong similarity with Saccharomyces cerevisiae protein Cdc27, and the gene product of Schizosaccharomyces pombe nuc 2. It is a component of the Anaphase Promoting Complex (APC), which is composed of eight protein subunits and is highly conserved in eucaryotic cells. The APC catalyzes the formation of the cyclin B ubiquitin conjugate that is responsible for the ubiquitin mediated proteolysis of B type cyclins. This protein and 3 other members of the APC complex contain the TPR (tetratricopeptide repeat), a protein domain important for protein protein interaction. This protein was shown to interact with mitotic checkpoint proteins including Mad2, p55CDC and BUBR1, and thus may be involved in controlling the timing of mitosis.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CDC27