Cdc14A Antibody (1F11)

Images

 
Western Blot: Cdc14A Antibody (1F11) [H00008556-M02] - Analysis of CDC14A expression in transfected 293T cell line by CDC14A monoclonal antibody (M02), clone 1F11.Lane 1: CDC14A transfected lysate(66.6 KDa).Lane 2: ...read more
Immunocytochemistry/ Immunofluorescence: Cdc14A Antibody (1F11) [H00008556-M02] - Analysis of monoclonal antibody to CDC14A on HeLa cell. Antibody concentration 10 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF
Clone
1F11
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Cdc14A Antibody (1F11) Summary

Immunogen
CDC14A (NP_003663 431 a.a. - 530 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. PFRLSSSLQGSAVTLKTSKMALSPSATAKRINRTSLSSGATVRSFSINSRLASSLGNLNAATDDPENKKTSSSSKAGFTASPFTNLLNGSSQPTTRNYPE
Specificity
CDC14A - CDC14 cell division cycle 14 homolog A (S. cerevisiae)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
CDC14A
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
Application Notes
Antibody reactivity against recombinant protein for WB. It has been used for IF and ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Cdc14A Antibody (1F11)

  • CDC10 (cell division cycle 10, S. cerevisiae, homolog)
  • CDC14 cell division cycle 14 homolog A (S. cerevisiae)
  • CDC14 cell division cycle 14 homolog A
  • cdc14
  • Cdc14A1
  • Cdc14A2
  • dual specificity protein phosphatase CDC14A
  • EC 3.1.3.16
  • EC 3.1.3.48
  • hCDC14

Background

The protein encoded by this gene is a member of the dual specificity protein tyrosine phosphatase family. It is highly similar to Saccharomyces cerevisiae Cdc14, a protein tyrosine phosphatase involved in the exit of cell mitosis and initiation of DNA replication, suggesting a role in cell cycle control. This protein has been shown to interact with, and dephosphorylate tumor suppressor protein p53, and is thought to regulate the function of p53. Alternative splicing of this gene results in several transcript variants encoding distinct isoforms.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-85729
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00008555-B01P
Species: Hu
Applications: WB, ICC/IF
NBP2-58701
Species: Hu
Applications: ICC/IF
NBP2-13955
Species: Hu
Applications: IHC, IHC-P
NBP1-60120
Species: Hu
Applications: WB, TCS
NBP2-33867
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-46648
Species: Hu, Mu, Rt
Applications: IHC
NBP1-85720
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00009700-M01
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
AF4885
Species: Mu
Applications: WB, IP
NB100-91662
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-15840
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-77310
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P, IF
NB500-106
Species: Hu, Mu, Rt, Po, Ch, Dr, Fi, Pm, Rb, Ye, Ze
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
AF748
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NBP1-85727
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-33687
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00008556-M02
Species: Hu
Applications: WB, ELISA, ICC/IF

Publications for Cdc14A Antibody (H00008556-M02) (0)

There are no publications for Cdc14A Antibody (H00008556-M02).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Cdc14A Antibody (H00008556-M02) (0)

There are no reviews for Cdc14A Antibody (H00008556-M02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Cdc14A Antibody (H00008556-M02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Cdc14A Products

Bioinformatics Tool for Cdc14A Antibody (H00008556-M02)

Discover related pathways, diseases and genes to Cdc14A Antibody (H00008556-M02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Cdc14A Antibody (H00008556-M02)

Discover more about diseases related to Cdc14A Antibody (H00008556-M02).
 

Pathways for Cdc14A Antibody (H00008556-M02)

View related products by pathway.

PTMs for Cdc14A Antibody (H00008556-M02)

Learn more about PTMs related to Cdc14A Antibody (H00008556-M02).
 

Research Areas for Cdc14A Antibody (H00008556-M02)

Find related products by research area.

Blogs on Cdc14A

There are no specific blogs for Cdc14A, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Cdc14A Antibody (1F11) and receive a gift card or discount.

Bioinformatics

Gene Symbol CDC14A
Entrez
OMIM
Uniprot