CDAN1 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: CDAN1 Antibody [NBP1-84574] - Staining of human cell line U-251 MG shows positivity in plasma membrane and cytoplasm.
Immunohistochemistry-Paraffin: CDAN1 Antibody [NBP1-84574] - Staining of human rectum shows strong cytoplasmic and membranous positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CDAN1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:NCVKHIKATLVADLVRQAESLLQEQLVTQGEEGGDPAQLLEILCSQLCPHGAQALALGREFCQRKSPGAVRALLPEETPAAVLSSAENIAVGLA
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (91%), Rat (90%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CDAN1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:500-1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
CDAN1 Protein (NBP1-84574PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for CDAN1 Antibody

  • CDA1
  • CDAI
  • CDA-I
  • codanin
  • codanin-1
  • congenital dyserythropoietic anemia, type I
  • discs lost homolog
  • DLT
  • PRO1295

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF5739
Species: Hu, Mu, Rt
Applications: WB
AF4928
Species: Hu
Applications: WB, Flow, CyTOF-ready
NBP2-47476
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-57578
Species: Hu
Applications: WB
NBP1-87349
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-88036
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
NBP2-07799
Species: Hu
NBP2-47602
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF5415
Species: Hu
Applications: WB, IHC, ICC
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB100-74413
Species: Hu, Mu, Rb
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-20383
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for CDAN1 Antibody (NBP1-84574) (0)

There are no publications for CDAN1 Antibody (NBP1-84574).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CDAN1 Antibody (NBP1-84574) (0)

There are no reviews for CDAN1 Antibody (NBP1-84574). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for CDAN1 Antibody (NBP1-84574) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CDAN1 Products

Bioinformatics Tool for CDAN1 Antibody (NBP1-84574)

Discover related pathways, diseases and genes to CDAN1 Antibody (NBP1-84574). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CDAN1 Antibody (NBP1-84574)

Discover more about diseases related to CDAN1 Antibody (NBP1-84574).
 

Pathways for CDAN1 Antibody (NBP1-84574)

View related products by pathway.

PTMs for CDAN1 Antibody (NBP1-84574)

Learn more about PTMs related to CDAN1 Antibody (NBP1-84574).

Blogs on CDAN1

There are no specific blogs for CDAN1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CDAN1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CDAN1