Recombinant Human CD9 Protein

Product Discontinued

Recombinant Human CD9 Protein Summary

• Description: A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1-228 of Human CD9 full-length ORF
  
  

  Source: Wheat Germ (in vitro)

  Amino Acid Sequence:MPVKGGTKCIKYLLFGFNFIFWLAGIAVLAIGLWLRFDSQTKSIFEQETNNNNSSFYTGVYILIGAGALMMLVGFLGCCGAVQESQCMLGLFFGFLLVIFAIEIAAAIWGYSHKDEVIKEVQEFYKDTYNKLKTKDEPQRETLKAIHYALNCCGLAGGVEQFISDICPKKDVLETFTVKSCPDAIKEVFDNKFHIIGAVGIGIAVVMIFGMIFSMILCCAIRRNREMV

• Protein/Peptide Type: Recombinant Protein
• Gene: CD9

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
• Application Notes: Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

• Storage: Store at -80C. Avoid freeze-thaw cycles.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human CD9 Protein

• BA2
• BA-2/p24 antigen
• BTCC-1
• CD9 antigen
• CD9 molecule
• CD9
• Cell growth-inhibiting gene 2 protein
• DRAP-27
• Leukocyte antigen MIC3
• MIC3
• motility related protein-1,5H9 antigen
• Motility-related protein
• MRP-1FLJ99568
• p24
• tetraspanin-29
• TSPAN29
• TSPAN-29
• TSPAN29MIC3CD9 antigen (p24)

Background

The protein encoded by this gene is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility. This encoded protein is a cell surface glycoprotein that is known to complex with integrins and other transmembrane 4 superfamily proteins. It can modulate cell adhesion and migration and also trigger platelet activation and aggregation. In addition, the protein appears to promote muscle cell fusion and support myotube maintenance. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CD9