CD9 Antibody (4A2)

Immunocytochemistry/Immunofluorescence: CD9 Antibody (4A2) [H00000928-M01] - Analysis of monoclonal antibody to CD9 on HeLa cell . Antibody concentration 10 ug/ml.

ELISA: CD9 Antibody (4A2) [H00000928-M01] - Detection limit for recombinant GST tagged CD9 is approximately 1ng/ml as a capture antibody.

Product Discontinued

CD9 Antibody (4A2) Summary

• Description: Quality control test: Antibody Reactive Against Recombinant Protein.
• Immunogen: CD9 (AAH11988, 112 a.a. ~ 195 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. SHKDEVIKEVQEFYKDTYNKLKTKDEPQRETLKAIHYALNCCGLAGGVEQFISDICPKKDVLETFTVKSCPDAIKEVFDNKFHI
• Specificity: CD9 - CD9 antigen (p24) (4A2)
• Isotype: IgG2a Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: CD9
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunocytochemistry/ Immunofluorescence
  • Western Blot 1:500
• Application Notes: Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for CD9 Antibody (4A2)

• BA2
• BA-2/p24 antigen
• BTCC-1
• CD9 antigen
• CD9 molecule
• CD9
• Cell growth-inhibiting gene 2 protein
• DRAP-27
• Leukocyte antigen MIC3
• MIC3
• motility related protein-1,5H9 antigen
• Motility-related protein
• MRP-1FLJ99568
• p24
• tetraspanin-29
• TSPAN29
• TSPAN-29
• TSPAN29MIC3CD9 antigen (p24)

Background

The protein encoded by this gene is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility. This encoded protein is a cell surface glycoprotein that is known to complex with integrins and other transmembrane 4 superfamily proteins. It can modulate cell adhesion and migration and also trigger platelet activation and aggregation. In addition, the protein appears to promote muscle cell fusion and support myotube maintenance. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CD9
• Entrez:
  • 928(Human)
• Uniprot:
  • AAH11988(Human)