CD40 Ligand/TNFSF5 Recombinant Protein Antigen

Images

 
There are currently no images for CD40 Ligand/TNFSF5 Recombinant Protein Antigen (NBP3-16982PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

CD40 Ligand/TNFSF5 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CD40 Ligand/TNFSF5

Source: E. coli

Amino Acid Sequence: EMQKGDQNPQIAAHVISEASSKTTSVLQWAEKGYYTMSNNLVTLENGKQL

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
CD40LG
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-16982.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
23 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for CD40 Ligand/TNFSF5 Recombinant Protein Antigen

  • CD154 antigen
  • CD154
  • CD40 antigen ligand
  • CD40 Ligand
  • CD40L
  • CD40-L
  • CD40LG
  • CD40LIGM
  • gp39
  • hCD40L
  • HIGM1
  • T-B cell-activating molecule
  • T-BAM
  • T-cell antigen Gp39
  • TNF-related activation protein
  • TNFSF5
  • TNFSF5IMD3
  • TRAP
  • TRAPtumor necrosis factor (ligand) superfamily, member 5 (hyper-IgM syndrome)
  • tumor necrosis factor (ligand) superfamily member 5
  • Tumor necrosis factor ligand superfamily member 5

Background

CD40L is the ligand for CD40, a member of the tumor necrosis factor (TNF) receptor superfamily. CD40L is expressed mainly on activated CD4+ T-lymphocytes as a single-pass type II membrane protein. Proteolytic processing of the membrane form results in a soluble secreted form of CD40L.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF632
Species: Hu
Applications: AgAct, Simple Western, WB
7268-CT
Species: Hu
Applications: BA
6507-IL/CF
Species: Hu
Applications: BA
NBP2-79843
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC,  IHC-P, PA, WB
NB100-524
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
MAB140
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, IHC, Neut
202-IL
Species: Hu
Applications: BA
NBP1-19371
Species: Ca, Hu, Mu, Po, Rb, Rt
Applications: Dual ISH-IHC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, Simple Western, WB
DY417
Species: Mu
Applications: ELISA
M6000B
Species: Mu
Applications: ELISA
NBP2-25208
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, KO, Simple Western, WB
462-TEC
Species: Mu
Applications: BA
NBP1-72042
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, PEP-ELISA, WB
MAB342
Species: Hu
Applications: AgAct, ICC, WB
137-PS
Species: Hu
Applications: BA
NBP1-49045
Species: Mu, Rt
Applications: Cell Depl, CyTOF-ready, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, InhibTFunc
NB100-56508
Species: Av, Hu, Mu, Rt
Applications: CyTOF-ready, Flow-IC, Flow, IHC,  IHC-P, WB
DY805
Species: Hu
Applications: ELISA

Publications for CD40 Ligand/TNFSF5 Recombinant Protein Antigen (NBP3-16982PEP) (0)

There are no publications for CD40 Ligand/TNFSF5 Recombinant Protein Antigen (NBP3-16982PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CD40 Ligand/TNFSF5 Recombinant Protein Antigen (NBP3-16982PEP) (0)

There are no reviews for CD40 Ligand/TNFSF5 Recombinant Protein Antigen (NBP3-16982PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for CD40 Ligand/TNFSF5 Recombinant Protein Antigen (NBP3-16982PEP). (Showing 1 - 1 of 1 FAQ).

  1. I am looking for paired ABs for use in detecting CD40L (rat) by ELISA. Do you have such a reagent(s) available?
    • Unfortunately we currently do not have any CD40 Ligand antibody pairs that have been validated in Rat. The only antibody pairs we offer for CD40L are validated in Human. I apologize for this inconvenience. If you would be interested in testing one of our products in Rat I'd like to invite you to participate in our Innovators Reward Program. Please contact us at innovators@novusbio.com with any questions regarding this program.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our CD40 Ligand/TNFSF5 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol CD40LG