| Reactivity | HuSpecies Glossary |
| Applications | AC |
| Description | A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CD34. Source: E. coli Amino Acid Sequence: LMNRRSWSPTGERLGEDPYYTENGGGQGYSSGPGTSPEAQGKASVNRGAQENGTGQATSRNGHSARQHVVADTEL Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G) This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions. |
| Source | E. coli |
| Protein/Peptide Type | Recombinant Protein Antigen |
| Gene | CD34 |
| Purity | >80% by SDS-PAGE and Coomassie blue staining |
| Dilutions |
|
| Application Notes | This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-38322. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com |
| Theoretical MW | 25 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
| Storage | Store at -20C. Avoid freeze-thaw cycles. |
| Buffer | PBS and 1M Urea, pH 7.4. |
| Preservative | No Preservative |
| Purity | >80% by SDS-PAGE and Coomassie blue staining |
Research Areas for CD34 Recombinant Protein Antigen (NBP2-38322PEP)Find related products by research area.
|
|
Understanding ‘Y’ in Breast Cancer: Crucial Role of DNA/RNA-binding Protein YB-1 in the Development, Pre-Invasive, and Metastatic Phases Jamshed Arslan, Pharm D, PhD In the United States, 1 in 8 women will be diagnosed with breast cancer in her lifetime.1 Despite the prevalence, cancer genesis is a mystery. The heterogeneity of cancers makes it diff... Read full blog post. |
|
The application of CD31/Pecam-1 (MEC 7.46) in breast cancer research CD31/PECAM-1, or platelet endothelial cell adhesion molecule 1, is a 130-kDa glycoprotein expressed on vascular and hematopoietic cells. Depending on the cell type, CD31/PECAM-1 expression can be largely localized to cell junctions, playing a rol... Read full blog post. |
|
CD68 (Cluster of differentiation 68, GP110, LAMP4, SCARD1) CD68 belongs to a growing family of hematopoietic mucin-like molecules known as lysosomal/endosomal-associated membrane glycoproteins (LAMPs). Other LAMP family members included leukosialin, stem cell antigen CD34, and GlyCAM-1. CD68 encodes a 110-kD ... Read full blog post. |
|
CD34 (Cluster of differentiation 34, hematopoietic progenitor cell antigen) CD34 is a cell-surface glycoprotein type 1 transmembrane protein that belongs to the sialomucin family. CD34 comprises of an intracellular cytoplasmic domain with consensus sites for serine, threonine, tyrosine and active protein kinase C (PKC). Becau... Read full blog post. |
|
CD34 Serves as an Important Marker in Disease Research CD34 is a membrane protein that aids cells in cell-cell adhesion. Although little is known about its function, CD34 is an important marker for hematopoietic stem cells (HSCs), muscle satellite cells, and endothelial c... Read full blog post. |
|
CD34 Serves as an Important Marker in Disease Research CD34 is a cell surface glycoprotein that aids cells in cell-cell adhesion. It is expressed on endothelial cells where it is known to bind L-selectin and may aid in migration of T-cells. Moreover, it is expressed on hematopoietic stem cells (HSC), musc... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | CD34 |