CD34 Recombinant Protein Antigen

Images

 
There are currently no images for CD34 Protein (NBP2-38321PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

CD34 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CD34.

Source: E.coli

Amino Acid Sequence: ATSPTKPYTSSSPILSDIKAEIKCSGIREVKLTQGICLEQNKTSSCAEFKKDRGEGLARVLCGEEQADADAG

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
CD34
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP2-38321.
Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed.

For further blocking peptide related information and a protocol, click here.
Theoretical MW
25 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for CD34 Recombinant Protein Antigen

  • CD34 antigenhematopoietic progenitor cell antigen CD34
  • CD34 molecule
  • CD34
  • HPCA1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-84550
Species: Hu
Applications: WB, IHC, IHC-P
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
AF1356
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready
NB100-77417
Species: Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vivo, CyTOF-ready
AF3628
Species: Mu, Rt
Applications: WB, Flow, IHC, CyTOF-ready, ICC
NB110-41083
Species: Hu
Applications: WB, ChIP, ELISA
7270-IL/CF
Species: Hu
NB300-223
Species: Hu, Mu, Rt, Po, Bv, Ch, Eq
Applications: WB, ICC/IF, ICC
NBP2-25250
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
288-TPN/CF
Species: Hu
NBP2-22377
Species: Hu
Applications: WB, IHC, IHC-P
7954-GM/CF
Species: Hu
NBP2-38321PEP
Species: Hu
Applications: AC

Publications for CD34 Protein (NBP2-38321PEP) (0)

There are no publications for CD34 Protein (NBP2-38321PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CD34 Protein (NBP2-38321PEP) (0)

There are no reviews for CD34 Protein (NBP2-38321PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

FAQs for CD34 Protein (NBP2-38321PEP). (Showing 1 - 1 of 1 FAQ).

  1. I wonder if you have a CD105 or CD34 antibody suitable for IHC that is specific for human and do not bind mouse?
    • We do not have any anti-human CD34 or CD105 antibodies that are confirmed to NOT detect the mouse protein. When we have tested an antibody and confirmed that it will not react with mouse samples, we will add Mu(-) to the datasheet, and unfortunately all of our CD105 and CD34 antibodies will either detect the mouse protein, or they have not been used in mouse samples before.

Additional Array Products

Bioinformatics Tool for CD34 Protein (NBP2-38321PEP)

Discover related pathways, diseases and genes to CD34 Protein (NBP2-38321PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CD34 Protein (NBP2-38321PEP)

Discover more about diseases related to CD34 Protein (NBP2-38321PEP).
 

Pathways for CD34 Protein (NBP2-38321PEP)

View related products by pathway.

PTMs for CD34 Protein (NBP2-38321PEP)

Learn more about PTMs related to CD34 Protein (NBP2-38321PEP).
 

Research Areas for CD34 Protein (NBP2-38321PEP)

Find related products by research area.

Blogs on CD34.

The application of CD31/Pecam-1 (MEC 7.46) in breast cancer research
CD31/PECAM-1, or platelet endothelial cell adhesion molecule 1, is a 130-kDa glycoprotein expressed on vascular and hematopoietic cells.  Depending on the cell type, CD31/PECAM-1 expression can be largely localized to cell junctions, playing a rol...  Read full blog post.

CD68 (Cluster of differentiation 68, GP110, LAMP4, SCARD1)
CD68 belongs to a growing family of hematopoietic mucin-like molecules known as lysosomal/endosomal-associated membrane glycoproteins (LAMPs). Other LAMP family members included leukosialin, stem cell antigen CD34, and GlyCAM-1. CD68 encodes a 110-kD...  Read full blog post.

CD34 (Cluster of differentiation 34, hematopoietic progenitor cell antigen)
CD34 is a cell-surface glycoprotein type 1 transmembrane protein that belongs to the sialomucin family. CD34 comprises of an intracellular cytoplasmic domain with consensus sites for serine, threonine, tyrosine and active protein kinase C (PKC). Becau...  Read full blog post.

CD34 Serves as an Important Marker in Disease Research
CD34 is a membrane protein that aids cells in cell-cell adhesion. Although little is known about its function, CD34 is an important marker for hematopoietic stem cells (HSCs), muscle satellite cells, and endothelial cells. HSCs can be found in bone ma...  Read full blog post.

CD34 Serves as an Important Marker in Disease Research
CD34 is a cell surface glycoprotein that aids cells in cell-cell adhesion. It is expressed on endothelial cells where it is known to bind L-selectin and may aid in migration of T-cells. Moreover, it is expressed on hematopoietic stem cells (HSC), musc...  Read full blog post.

Customers Who Bought This Also Bought

GM-CSF
7954-GM-010/CF

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our CD34 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol CD34