CD2AP Antibody

Images

 
Western Blot: CD2AP Antibody [NBP1-90626] - Analysis in human cell lines A-431 and PC-3 using Anti-CD2AP antibody. Corresponding CD2AP RNA-seq data are presented for the same cell lines. Loading control: Anti-PFN1
Immunocytochemistry/ Immunofluorescence: CD2AP Antibody [NBP1-90626] - Immunofluorescent staining of human cell line U-251 MG shows localization to plasma membrane & cytosol.
Immunohistochemistry-Paraffin: CD2AP Antibody [NBP1-90626] - Staining of human placenta shows strong cytoplasmic positivity in trophoblastic cells.
Western Blot: CD2AP Antibody [NBP1-90626] - Analysis in human cell line CACO-2.
Western Blot: CD2AP Antibody [NBP1-90626] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CD2AP Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:WSGTLNNKLGLFPSNFVKELEVTDDGETHEAQDDSETVLAGPTSPIPSLGNVSETASGSVTQPKKIRGIGFGDIFKEGSVKLRTRTSSSETEEKKPEKPLILQSLGPKTQSVEITKTDTEGKIKAKE
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CD2AP
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
CD2AP Protein (NBP1-90626PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for CD2AP Antibody

  • adapter protein CMS
  • Cas ligand with multiple Src homology 3 (SH3) domains
  • CD2AP
  • CD2-associated protein
  • CMS
  • DKFZp586H0519

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF3159
Species: Mu
Applications: WB, IHC
NBP1-85614
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-89818
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-37574
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC
248-BD/CF
Species: Hu, Mu, Rt, Ca, Eq
NBP1-26666
Species: Mu
Applications: B/N, Flow, IP, In vitro
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-20383
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-02623
Species: Hu, Rt, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-39100
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB110-60011
Species: Hu, Mu
Applications: WB, Simple Western, IHC, IHC-Fr, IHC-P, IP
NBP1-87679
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-00532
Species: Hu, Mu, Rt, Ca, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-85047
Species: Hu, Po
Applications: Simple Western, ICC/IF, IHC, IHC-P, ICC
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)

Publications for CD2AP Antibody (NBP1-90626) (0)

There are no publications for CD2AP Antibody (NBP1-90626).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CD2AP Antibody (NBP1-90626) (0)

There are no reviews for CD2AP Antibody (NBP1-90626). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for CD2AP Antibody (NBP1-90626) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CD2AP Products

CD2AP NBP1-90626

Bioinformatics Tool for CD2AP Antibody (NBP1-90626)

Discover related pathways, diseases and genes to CD2AP Antibody (NBP1-90626). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CD2AP Antibody (NBP1-90626)

Discover more about diseases related to CD2AP Antibody (NBP1-90626).
 

Pathways for CD2AP Antibody (NBP1-90626)

View related products by pathway.

PTMs for CD2AP Antibody (NBP1-90626)

Learn more about PTMs related to CD2AP Antibody (NBP1-90626).

Blogs on CD2AP

There are no specific blogs for CD2AP, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CD2AP Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CD2AP
Entrez