CD21 Recombinant Protein Antigen

Images

 
There are currently no images for CD21 Protein (NBP2-38684PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

CD21 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CR2.

Source: E. coli

Amino Acid Sequence: RLPTCVSVFPLECPALPMIHNGHHTSENVGSIAPGLSVTYSCESGYLLVGEKIINCLSSGKWSAVPPTCEEARCKSLGRFPNGKVKEPPILRVGVTANF

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
CR2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-38684.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for CD21 Recombinant Protein Antigen

  • C3DR
  • C3DRSLEB9
  • CD21 antigen
  • CD21
  • Complement C3d receptor
  • complement component (3d/Epstein Barr virus) receptor 2
  • complement receptor type 2
  • CR2
  • EBV receptor
  • Epstein-Barr virus receptor

Background

CD21 (complement receptor 2, CR2) binds C3 complement fragments, especially its breakdown fragments, which remain covalently attached to complement activating surfaces or antigen. CD21 has important roles in uptake and retention of immunocomplexes, survival of memory B cells and in development and maintenance of the humoral response to T-dependent antigens. CD21 also serves as a key receptor for Epstein-Barr virus binding and is involved in targeting prions to folicular dendritic cells and expediting neuroinvasion following peripheral exposure to prions. A soluble form of the CD21 (sCD21) is shed from the lymphocyte surface and retains its ability to bind respective ligands.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00003347-M01
Species: Hu
Applications: ELISA, ICC/IF, S-ELISA, WB
AF1106
Species: Hu
Applications: IP, WB
7268-CT
Species: Hu
Applications: BA
NBP2-79843
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC,  IHC-P, PA, WB
NB100-524
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
NBP2-29460
Species: Pm, Pm-Cm, Hu, Pm, RM
Applications: Flow, ICC/IF, IHC,  IHC-P, ISH
NB200-540
Species: Ec, Mu
Applications: CyTOF-ready, Flow-IC, Flow, IA, ICC/IF, IHC, IHC-Fr,  IHC-P, IP
NBP2-44520
Species: Ca(-), Hu, Rt(-)
Applications: Flow-IC, Flow, ICC/IF, IF, IHC,  IHC-P, MI, WB
NB600-534
Species: Hu, Mu, Po, V-Vi
Applications: ELISA, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, In vitro, In vivo, RIA, WB
NBP2-62693
Species: Hu
Applications: IHC,  IHC-P
MAB1455
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
NBP1-87581
Species: Hu
Applications: IHC,  IHC-P, WB
MAB6495
Species: Hu
Applications: ICC, Simple Western, WB
NBP2-25196
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC/IF, In vitro, WB
AF3846
Species: Hu, Mu, Rt
Applications: IHC, WB
H00347527-P01
Species: Hu
Applications: ELISA, AP, PA, WB
AF123
Species: Hu
Applications: Block, ICC, WB
AF3398
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
NBP2-38684PEP
Species: Hu
Applications: AC

Publications for CD21 Protein (NBP2-38684PEP) (0)

There are no publications for CD21 Protein (NBP2-38684PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CD21 Protein (NBP2-38684PEP) (0)

There are no reviews for CD21 Protein (NBP2-38684PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for CD21 Protein (NBP2-38684PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional CD21 Products

Research Areas for CD21 Protein (NBP2-38684PEP)

Find related products by research area.

Blogs on CD21.

How To Identify B Cell Subsets Using Flow Cytometry
By Victoria OsinskiUsing Flow Cytometry to Identify B Cell SubsetsIdentifying cellular subsets by flow cytometry requires careful and thorough planning in order to ensure the correct subset of cells are identified...  Read full blog post.

CD19: An Undoubted Biomarker for B Cells
CD19 is a cell surface protein member of the large immunoglobulin superfamily that complexes with CD21, CD81, and CD225 in the membrane of mature B-cells. A major function of CD19 is to assemble with the antigen receptor of B-lymphocytes to decrease t...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our CD21 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol CR2