CD1c/BDCA-1 Antibody (4B11)

Images

 
Sandwich ELISA: CD1c/BDCA-1 Antibody (4B11) [H00000911-M02] - Detection limit for recombinant GST tagged CD1C is 0.3 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ELISA
Clone
4B11
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

CD1c/BDCA-1 Antibody (4B11) Summary

Immunogen
CD1C (NP_001756 77 a.a. - 185 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. SNEELSDLELLFRFYLFGLTREIQDHASQDYSKYPFEVQVKAGCELHSGKSPEGFFQVAFNGLDLLSFQNTTWVPSPGCGSLAQSVCHLLNHQYEGVTETVYNLIRSTC
Specificity
CD1C (4B11)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
CD1C
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
Application Notes
Antibody reactivity against recombinant protein on ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for CD1c/BDCA-1 Antibody (4B11)

  • BDCA1
  • BDCA-1
  • c polypeptide
  • CD1
  • CD1A
  • CD1c antigen
  • CD1c molecule
  • CD1c
  • cortical thymocyte antigen CD1C
  • differentiation antigen CD1-alpha-3
  • R7
  • T-cell surface glycoprotein CD1c

Background

This gene encodes a member of the CD1 family of transmembrane glycoproteins, which are structurally related to the major histocompatibility complex (MHC) proteins and form heterodimers with beta-2-microglobulin. The CD1 proteins mediate the presentation of primarily lipid and glycolipid antigens of self or microbial origin to T cells. The human genome contains five CD1 family genes organized in a cluster on chromosome 1. The CD1 family members are thought to differ in their cellular localization and specificity for particular lipid ligands. The protein encoded by this gene is broadly distributed throughout the endocytic system via a tyrosine-based motif in the cytoplasmic tail. Alternatively spliced transcript variants of this gene have been observed, but their full-length nature is not known.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA
NBP1-43461
Species: Mu
Applications: Flow, IHC, IP
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-49045
Species: Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Cell Depl, CyTOF-ready, InhibTFunc
NBP1-92684
Species: Hu, Mu, Rt, Po, Bv
Applications: WB, ICC/IF
NBP2-24867
Species: Hu, Mu
Applications: Flow, Func, In vitro, In vivo, CyTOF-ready, Flow-CS
NB120-6405
Species: Rt
Applications: B/N, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
MAB1774
Species: Hu
Applications: Flow, CyTOF-ready, ICC
NBP1-26666
Species: Mu
Applications: B/N, Flow, IP, In vitro
NBP1-88968
Species: Hu
Applications: WB, IHC, IHC-P

Publications for CD1c/BDCA-1 Antibody (H00000911-M02) (0)

There are no publications for CD1c/BDCA-1 Antibody (H00000911-M02).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CD1c/BDCA-1 Antibody (H00000911-M02) (0)

There are no reviews for CD1c/BDCA-1 Antibody (H00000911-M02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for CD1c/BDCA-1 Antibody (H00000911-M02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CD1c/BDCA-1 Products

Bioinformatics Tool for CD1c/BDCA-1 Antibody (H00000911-M02)

Discover related pathways, diseases and genes to CD1c/BDCA-1 Antibody (H00000911-M02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CD1c/BDCA-1 Antibody (H00000911-M02)

Discover more about diseases related to CD1c/BDCA-1 Antibody (H00000911-M02).
 

Pathways for CD1c/BDCA-1 Antibody (H00000911-M02)

View related products by pathway.

PTMs for CD1c/BDCA-1 Antibody (H00000911-M02)

Learn more about PTMs related to CD1c/BDCA-1 Antibody (H00000911-M02).

Blogs on CD1c/BDCA-1

There are no specific blogs for CD1c/BDCA-1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CD1c/BDCA-1 Antibody (4B11) and receive a gift card or discount.

Bioinformatics

Gene Symbol CD1C
Entrez
OMIM
Uniprot