We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

CD1a Recombinant Protein Antigen

Images

 
There are currently no images for CD1a Protein (NBP1-86560PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

CD1a Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CD1A.

Source: E. coli

Amino Acid Sequence: QNLVSGWLSDLQTHTWDSNSSTIVFLCPWSRGNFSNEEWKELETLFRIRTIRSFEGIRRYAHELQFEYPFEIQVTGGCELHSGKVSGSFLQLAYQGSDFVSFQNNSWLPYPVAGNMAKHFCKVLNQNQHEND

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
CD1A
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-86560.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
33 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for CD1a Recombinant Protein Antigen

  • CD1
  • CD1a antigen
  • CD1A antigen, a polypeptide
  • CD1a molecule
  • CD1a
  • cluster of differentiation 1 A
  • cortical thymocyte antigen CD1A
  • differentiation antigen CD1-alpha-3
  • epidermal dendritic cell marker CD1a
  • FCB6
  • hTa1 thymocyte antigen
  • HTA1
  • R4
  • T6
  • T-cell surface antigen T6/Leu-6
  • T-cell surface glycoprotein CD1a

Background

All CD1 molecules, except CD1e, are cell surface glycoproteins that are structurally related to the MHC molecules, however, in distinction, CD1 proteins are essentially non polymorphic. CD1 has considerable structural homology with both MHC class I and class II molecules, and CD1 molecules are involved in T cell activation. In contrast to MHC, however, CD1 molecules appear to present predominantly non peptide molecules originating from lipids and glycolipids.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB6979
Species: Hu
Applications: WB
7268-CT
Species: Hu
Applications: BA
NBP2-79843
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC,  IHC-P, PA, WB
NB100-524
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
NBP2-92630
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
6507-IL/CF
Species: Hu
Applications: BA
NBP1-19371
Species: Ca, Hu, Mu, Po, Rb, Rt
Applications: Dual ISH-IHC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, Simple Western, WB
NBP1-49045
Species: Mu
Applications: Cell Depl, CyTOF-ready, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, InhibTFunc
NBP1-72042
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, PEP-ELISA, WB
MAB7330
Species: Hu
Applications: CyTOF-ready, ICFlow
485-MI
Species: Mu
Applications: BA
NB120-6405
Species: Rt
Applications: B/N, CyTOF-ready, EM, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP
NB600-1441
Species: Ca, Hu, Mu, Po
Applications: Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, KD
NBP2-25200
Species: Hu
Applications: B/N, Flow, IHC, IHC-Fr, WB
NBP1-31661
Species: Hu, Mu, Rt, Ze
Applications: ICC/IF, IHC,  IHC-P, Simple Western, WB
NBP1-89284
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, KD, WB
NBP2-21792
Species: Hu
Applications: CyTOF-ready, Flow, ICC/IF, IHC,  IHC-P, IP, WB
MAB7446
Species: Hu
Applications: CyTOF-ready, Flow
NBP1-86560PEP
Species: Hu
Applications: AC

Publications for CD1a Protein (NBP1-86560PEP) (0)

There are no publications for CD1a Protein (NBP1-86560PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CD1a Protein (NBP1-86560PEP) (0)

There are no reviews for CD1a Protein (NBP1-86560PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for CD1a Protein (NBP1-86560PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional CD1a Products

Research Areas for CD1a Protein (NBP1-86560PEP)

Find related products by research area.

Blogs on CD1a

There are no specific blogs for CD1a, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our CD1a Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol CD1A