| Reactivity | HuSpecies Glossary |
| Applications | AC |
| Description | A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CD11c. Source: E. coli Amino Acid Sequence: QDGLVDLAVGARGQVLLLRTRPVLWVGVSMQFIPAEIPRSAFECREQVVSEQTLVQSNICLYIDKRSKNLLGSRDLQSSVTLDLALDPGRLSPRATFQETKNRSLSRVRV Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G) This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions. |
| Source | E. coli |
| Protein/Peptide Type | Recombinant Protein Antigen |
| Gene | ITGAX |
| Purity | >80% by SDS-PAGE and Coomassie blue staining |
| Dilutions |
|
| Application Notes | This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-34491. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com |
| Theoretical MW | 30 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
| Storage | Store at -20C. Avoid freeze-thaw cycles. |
| Buffer | PBS and 1M Urea, pH 7.4. |
| Preservative | No Preservative |
| Purity | >80% by SDS-PAGE and Coomassie blue staining |
Research Areas for CD11c Recombinant Protein Antigen (NBP2-34491PEP)Find related products by research area.
|
|
Read full blog post. |
|
CD11b: Marker for a New Type of B Cell that Participates in Cell-Mediated Immunity Think B lymphocytes just produce antibodies? Think again! Although, of course, B cells are vital for the humoral immune response, many studies in recent years have begun to uncover antibody-independent actions of B cells: regulating T cells and thus a... Read full blog post. |
|
Adhesion Receptor Molecule CD11b/c is the Point of Entry for many Infectious Diseases Pathogenic microorganisms utilize a variety of cell surface receptors to gain entry into host cells and to bypass the natural defense mechanisms. One of the most prominent receptors used in this fashion is the leukocyte adhesion receptor CD11b/c. This... Read full blog post. |
|
CD11b/CD18 and Neutrophil-Epithelial Interactions as Targets for Anti-Inflammatory Therapies The beta-2 integrins, a family of four cell surface transmembrane glycoproteins expressed only on leukocytes, include CD11a/CD18, CD11b/CD18, CD11c/CD18, and CD11d/CD18. They consist of a common beta subunit (CD18) and homologous alpha subunits (CD11a... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | ITGAX |