Recombinant Human CD11c GST (N-Term) Protein

Images

 
SDS-Page: Recombinant Human CD11c Protein [H00003687-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, MA, AP

Order Details

Recombinant Human CD11c GST (N-Term) Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 114-223 of Human CD11c

Source: Wheat Germ (in vitro)

Amino Acid Sequence: HECGRNMYLTGLCFLLGPTQLTQRLPVSRQECPRQEQDIVFLIDGSGSISSRNFATMMNFVRAVISQFQRPSTQFSLMQFSNKFQTHFTFEEFRRSSNPLSLLASVHQLQ

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Recombinant Protein
Gene
ITGAX
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
Theoretical MW
37.84 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human CD11c GST (N-Term) Protein

  • 95 alpha chain
  • 95
  • 95, alpha subunit
  • CD11 antigen-like family member C
  • CD11c antigen
  • CD11c
  • CD11Cleu M5, alpha subunit
  • Integrin alpha X
  • integrin alpha-X
  • integrin, alpha X (antigen CD11C (p150), alpha polypeptide)
  • integrin, alpha X (complement component 3 receptor 4 subunit)
  • ITGAX
  • Leu M5
  • Leukocyte adhesion glycoprotein p150
  • Leukocyte adhesion receptor p150
  • leukocyte surface antigen p150
  • myeloid membrane antigen, alpha subunit
  • p150 95 integrin alpha chain
  • p150,95 alpha
  • SLEB6

Background

ITGAX - integrin, alpha X (antigen CD11C (p150), alpha polypeptide)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB110-89474
Species: Bv, Ce, ChHa, Hu, Pm, Mu, Rt, RM
Applications: Dual ISH-IHC, Flow-CS, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, ISH, Simple Western, Single-Cell Western, WB
NBP1-72042
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, PEP-ELISA, WB
7268-CT
Species: Hu
Applications: BA
NB100-524
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
NBP2-79843
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC,  IHC-P, PA, WB
AF1730
Species: Hu
Applications: AdBlk, CyTOF-ready, Flow, ICC
NBP1-19371
Species: Ca, Hu, Mu, Po, Rb, Rt
Applications: Dual ISH-IHC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, Simple Western, WB
NBP2-25208
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, KO, Simple Western, WB
MAB3595
Species: Hu
Applications: CyTOF-ready, Flow, Simple Western, WB
AF629
Species: Hu
Applications: CyTOF-ready, Flow, InhibCellGro, WB
MAB140
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, IHC, Neut
6507-IL/CF
Species: Hu
Applications: BA
NBP1-49045
Species: Mu, Rt
Applications: Cell Depl, CyTOF-ready, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, InhibTFunc
DY417
Species: Mu
Applications: ELISA
AF114
Species: Mu
Applications: CyTOF-ready, Flow, ICC, IHC, WB
AF632
Species: Hu
Applications: AgAct, Simple Western, WB
DC140
Species: Hu
Applications: ELISA
NBP2-93743
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
AF796
Species: Mu
Applications: AdBlk, IHC, WB

Publications for CD11c Partial Recombinant Protein (H00003687-Q01) (0)

There are no publications for CD11c Partial Recombinant Protein (H00003687-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CD11c Partial Recombinant Protein (H00003687-Q01) (0)

There are no reviews for CD11c Partial Recombinant Protein (H00003687-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CD11c Partial Recombinant Protein (H00003687-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional CD11c Products

Research Areas for CD11c Partial Recombinant Protein (H00003687-Q01)

Find related products by research area.

Blogs on CD11c.


  Read full blog post.

CD11b: Marker for a New Type of B Cell that Participates in Cell-Mediated Immunity
Think B lymphocytes just produce antibodies? Think again! Although, of course, B cells are vital for the humoral immune response, many studies in recent years have begun to uncover antibody-independent actions of B cells: regulating T cells and thus a...  Read full blog post.

Adhesion Receptor Molecule CD11b/c is the Point of Entry for many Infectious Diseases
Pathogenic microorganisms utilize a variety of cell surface receptors to gain entry into host cells and to bypass the natural defense mechanisms. One of the most prominent receptors used in this fashion is the leukocyte adhesion receptor CD11b/c. This...  Read full blog post.

CD11b/CD18 and Neutrophil-Epithelial Interactions as Targets for Anti-Inflammatory Therapies
The beta-2 integrins, a family of four cell surface transmembrane glycoproteins expressed only on leukocytes, include CD11a/CD18, CD11b/CD18, CD11c/CD18, and CD11d/CD18. They consist of a common beta subunit (CD18) and homologous alpha subunits (CD11a...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human CD11c GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol ITGAX