CCL3/MIP-1 alpha Antibody Summary
| Description |
Quality control test: Antibody reactive against mammalian transfected lysate. |
| Immunogen |
CCL3 (NP_002974, 1 a.a. - 92 a.a.) full-length human protein. MQVSTAALAVLLCTMALCNQFSASLAADTPTACCFSYTSRQIPQNFIADYFETSSQCSKPGVIFLTKRSRQVCADPSEEWVQKYVSDLELSA |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Mouse |
| Gene |
CCL3 |
| Purity |
Protein G purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
|
| Application Notes |
It has been used for WB. |
Packaging, Storage & Formulations
| Storage |
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.4) |
| Preservative |
No Preservative |
| Purity |
Protein G purified |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for CCL3/MIP-1 alpha Antibody
Background
MIP1 alpha belongs to the chemokine beta family. In vitro MIP1 alpha stimulates H2O2 production in human neutrophils. MIP1 alpha and MIP1 beta, two closely related but distinct proteins, were originally co-purified from medium conditioned by a LPS-stimulated murine macrophage cell line. Mature mouse MIP1 alpha shares approximately 77% and 70% amino acid identity with human MIP1 alpha and mouse MIP1 beta, respectively. MIP1 proteins are expressed primarily in T cells, B cells, and monocytes after antigen or mitogen stimulation. Has adhesive effects on lymphocytes. MIP1 alpha can inhibit the proliferation of hematopoietic stem cells in vitro as well as in vivo. A signal transducing receptor, designated the C-C chemokine receptor 1 (C-C CKR-1) with seven transmembrane domains that bind MIP1 alpha, MIP1 beta, MCP1 and RANTES with varying affinities, has been isolated.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: ELISA
Species: Hu
Applications: ELISA
Species: Hu
Applications: ELISA
Species: Hu
Applications: BA
Species: Mu
Applications: ELISA
Species: Hu
Applications: CyTOF-ready, Flow, ICC, Neut
Species: Hu
Applications: ELISA
Species: Hu
Applications: CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta), ICC, ICFlow, Neut, Simple Western, WB
Species: Hu
Applications: CyTOF-ready, Flow
Species: Mu
Applications: ELISA
Species: Hu
Applications: ELISA
Species: Mu
Applications: BA
Species: Mu
Applications: ELISA
Species: Mu
Applications: ELISA
Species: Mu
Applications: ELISA
Species: Hu
Applications: BA
Species: Hu
Applications: ELISA
Species: Hu
Applications: CyTOF-ready, Flow, IHC
Species: Ca, Hu, Mu, Po, Rb, Rt
Applications: Dual ISH-IHC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
Species: Hu
Applications: WB
Publications for Macrophage Inflammatory Protein 1 alpha Antibody (H00006348-B01P) (0)
There are no publications for Macrophage Inflammatory Protein 1 alpha Antibody (H00006348-B01P).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Macrophage Inflammatory Protein 1 alpha Antibody (H00006348-B01P) (0)
There are no reviews for Macrophage Inflammatory Protein 1 alpha Antibody (H00006348-B01P).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Macrophage Inflammatory Protein 1 alpha Antibody (H00006348-B01P) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional CCL3/MIP-1 alpha Products
Research Areas for Macrophage Inflammatory Protein 1 alpha Antibody (H00006348-B01P)
Find related products by research area.
|
Blogs on CCL3/MIP-1 alpha