CCL27/CTACK Antibody - BSA Free

Immunohistochemistry-Paraffin: CCL27/CTACK Antibody [NBP2-62684] - Staining of human skin shows high expression.

Immunohistochemistry-Paraffin: CCL27/CTACK Antibody [NBP2-62684] - Analysis in human skin and skeletal muscle tissues using Anti-CCL27 antibody. Corresponding CCL27 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: CCL27/CTACK Antibody [NBP2-62684] - Staining of human skeletal muscle shows low expression as expected.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

CCL27/CTACK Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit CCL27/CTACK Antibody - BSA Free (NBP2-62684) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: CTQLYRKPLSDKLLRKVIQVELQEADGDCHLQAFVLHLAQRSICIHPQNPSLSQWFEHQERKLHGTLPKLNFGMLR
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CCL27
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for CCL27/CTACK Antibody - BSA Free

• ALP
• C-C motif chemokine 27
• CCL27
• chemokine (C-C motif) ligand 27
• CTACK
• CTACKSmall-inducible cytokine A27
• CTAK
• cutaneous T-cell attracting chemokine
• Cutaneous T-cell-attracting chemokine
• ESKINE
• IL-11 Ralpha-locus chemokine
• ILC
• ILCCC chemokine ILC
• PESKY
• SCYA27IL-11 R-alpha-locus chemokine
• skinkine
• small inducible cytokine subfamily A (Cys-Cys), member 27

Background

The CCL27 gene is one of several CC cytokine genes clustered on the p-arm of chromosome 9. Cytokines are a family of secreted proteins involved in immunoregulatory and inflammatory processes. The CC cytokines are proteins characterized by two adjacent cysteine

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CCL27