CCL17/TARC Antibody (1F11)


Immunocytochemistry/ Immunofluorescence: CCL17/TARC Antibody (1F11) [H00006361-M02] - Analysis of monoclonal antibody to CCL17 on HeLa cell. Antibody concentration 10 ug/ml.

Product Details

Reactivity HuSpecies Glossary
Applications ELISA, ICC/IF

Order Details

CCL17/TARC Antibody (1F11) Summary

CCL17 (NP_002978, 24 a.a. - 94 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. ARGTNVGRECCLEYFKGAIPLRKLKTWYQTSEDCSRDAIVFVTVQGRAICSDPNNKRVKNAVKYLQSLERS
IgG2b Kappa
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunocytochemistry/Immunofluorescence
Application Notes
It has been used for ELISA.

Packaging, Storage & Formulations

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
PBS (pH 7.4)
No Preservative
IgG purified


Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for CCL17/TARC Antibody (1F11)

  • ABCD-2
  • CC chemokine TARC
  • C-C motif chemokine 17
  • CCL17
  • chemokine (C-C motif) ligand 17
  • MGC138273
  • SCYA17MGC138271
  • small inducible cytokine subfamily A (Cys-Cys), member 17
  • Small-inducible cytokine A17
  • T cell-directed CC chemokine
  • TARC
  • TARCA-152E5.3
  • Thymus and activation-regulated chemokine


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: Flow, CyTOF-reported
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
Species: Hu
Applications: Flow, IHC, CyTOF-ready, Neut
Species: Hu
Applications: ELISA, ICC/IF

Publications for CCL17/TARC Antibody (H00006361-M02) (0)

There are no publications for CCL17/TARC Antibody (H00006361-M02).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CCL17/TARC Antibody (H00006361-M02) (0)

There are no reviews for CCL17/TARC Antibody (H00006361-M02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for CCL17/TARC Antibody (H00006361-M02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional CCL17/TARC Products

Bioinformatics Tool for CCL17/TARC Antibody (H00006361-M02)

Discover related pathways, diseases and genes to CCL17/TARC Antibody (H00006361-M02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CCL17/TARC Antibody (H00006361-M02)

Discover more about diseases related to CCL17/TARC Antibody (H00006361-M02).

Pathways for CCL17/TARC Antibody (H00006361-M02)

View related products by pathway.

PTMs for CCL17/TARC Antibody (H00006361-M02)

Learn more about PTMs related to CCL17/TARC Antibody (H00006361-M02).

Blogs on CCL17/TARC

There are no specific blogs for CCL17/TARC, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our CCL17/TARC Antibody (1F11) and receive a gift card or discount.


Gene Symbol CCL17