CCL1/I-309/TCA-3 Antibody

Western Blot: CCL1/I-309/TCA-3 Antibody [H00006346-D01P] - Analysis of CCL1 expression in A-431.

Western Blot: CCL1/I-309/TCA-3 Antibody [H00006346-D01P] - Analysis of CCL1 expression in transfected 293T cell line by CCL1 polyclonal antibody.Lane 1: CCL1 transfected lysate(11.00 KDa).Lane 2: Non-transfected lysate.

Product Discontinued

CCL1/I-309/TCA-3 Antibody Summary

• Description: Quality control test: Antibody reactive against mammalian transfected lysate.
• Immunogen: CCL1 (NP_002972.1, 1 a.a. - 96 a.a.) full-length human protein. MQIITTALVCLLLAGMWPEDVDSKSMQVPFSRCCFSFAEQEIPLRAILCYRNTSSICSNEGLIFKLKRGKEACALDTVGWVQRHRKMLRHCPSKRK
• Specificity: CCL1 - chemokine (C-C motif) ligand 1,
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CCL1
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Western Blot
• Application Notes: Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB and also on transfected lysate in WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.4)
• Preservative: No Preservative
• Purity: Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for CCL1/I-309/TCA-3 Antibody

• C-C motif chemokine 1
• CCL1
• chemokine (C-C motif) ligand 1
• I-309
• inflammatory cytokine I-309
• P500
• SCYA1
• SCYA1Small-inducible cytokine A1
• SCYA2
• SISe
• small inducible cytokine A1 (I-309, homologous to mouse Tca-3)
• T lymphocyte-secreted protein I-309
• TCA3
• TCA-3

Background

This gene is one of several cytokine genes clustered on the q-arm of chromosome 17. Cytokines are a family of secreted proteins involved in immunoregulatory and inflammatory processes. The protein encoded by this gene is structurally related to the CXC subfamily of cytokines. Members of this subfamily are characterized by two cysteines separated by a single amino acid. This cytokine is secreted by activated T cells and displays chemotactic activity for monocytes but not for neutrophils. It binds to the chemokine receptor CCR8. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for CCL1/I-309/TCA-3 Antibody (H00006346-D01P)(1)

Publication using H00006346-D01P

• Reipschlaeger S, Kubatzky K, Taromi S et al. Toxin-induced RhoA activity mediates CCL1-triggered STAT signaling. J Biol Chem. 2012-02-06 [PMID: 22311973]

Bioinformatics

• Gene Symbol: CCL1
• Entrez:
  • 6346(Human)
• Uniprot:
  • NP_002972.1(Human)