CCDC6 Antibody - BSA Free

Immunohistochemistry: CCDC6 Antibody [NBP3-35636] - Immunohistochemistry analysis of paraffin-embedded Rat brain using CCDC6 Rabbit pAb at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.

Western Blot: CCDC6 Antibody [NBP3-35636] - Western blot analysis of lysates from HeLa cells using CCDC6 Rabbit pAb at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25 ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 60s.

Immunohistochemistry: CCDC6 Antibody [NBP3-35636] - Immunohistochemistry analysis of paraffin-embedded Human liver cancer using CCDC6 Rabbit pAb at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.

Western Blot: CCDC6 Antibody [NBP3-35636] - Western Blot analysis of lysates from HeLa cells using CCDC6 Rabbit pAbat 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25 ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 60s.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ELISA, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

CCDC6 Antibody - BSA Free Summary

• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 55-222 of human CCDC6 (NP_005427.2).
  
  Sequence:
  RLEELTNRLASLQQENKVLKIELETYKLKCKALQEENRDLRKASVTIQARAEQEEEFISNTLFKKIQALQKEKETLAVNYEKEEEFLTNELSRKLMQLQHEKAELEQHLEQEQEFQVNKLMKKIKKLENDTISKQLTLEQLRREKIDLENTLEQEQEALVNRLWKRMD
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CCDC6
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunocytochemistry/ Immunofluorescence 1:50 - 1:200
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 1:500 - 1:2000
• Theoretical MW: 53 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.01% Thimerosal
• Purity: Affinity purified

Alternate Names for CCDC6 Antibody - BSA Free

• coiled-coil domain containing 6
• D10S170Protein H4
• H4DNA segment on chromosome 10 (unique) 170
• Papillary thyroid carcinoma-encoded protein
• PTCFLJ32286
• TPCcoiled-coil domain-containing protein 6
• TST1

Background

CCDC6 is the product of the H4(D10S170) gene identified as a gene that exhibits frequent rearrangement with RET in papillary thyroid tumors. Alternate names for CCDC6 include protein H4, PTC, and D10S170.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CCDC6