CC2D1A Antibody - BSA Free

Western Blot: CC2D1A Antibody [NBP3-38114] - Western blot analysis of various lysates using CC2D1A Rabbit pAb at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 1s.

Immunohistochemistry: CC2D1A Antibody [NBP3-38114] - Immunohistochemistry analysis of paraffin-embedded Human esophageal cancer using CC2D1A Rabbit pAb at dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Immunohistochemistry: CC2D1A Antibody [NBP3-38114] - Immunohistochemistry analysis of paraffin-embedded Rat kidney using CC2D1A Rabbit pAb at dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ELISA, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

CC2D1A Antibody - BSA Free Summary

• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-150 of human CC2D1A (NP_060191.3).
  
  Sequence:
  MHKRKGPPGPPGRGAAAARQLGLLVDLSPDGLMIPEDGANDEELEAEFLALVGGQPPALEKLKGKGPLPMEAIEKMASLCMRDPDEDEEEGTDEDDLEADDDLLAELNEVLGEEQKASETPPPVAQPKPEAPHPGLETTLQERLALYQTA
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CC2D1A
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 1:1000 - 1:2000
• Theoretical MW: 104 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.01% Thimerosal
• Purity: Affinity purified

Alternate Names for CC2D1A Antibody - BSA Free

• Akt kinase-interacting protein 1
• coiled-coil and C2 domain containing 1A
• coiled-coil and C2 domain-containing protein 1A
• Five repressor element under dual repression-binding protein 1
• FLJ20241
• FLJ41160
• FRE under dual repression-binding protein 1
• FREUD-1
• mental retardation, nonsyndromic, autosomal recessive, 3
• MRT3Freud-1/Aki1
• Putative NF-kappa-B-activating protein 023N
• putative NFkB activating protein

Background

The CC2D1A gene encodes a transcriptional repressor that binds to a conserved 14-bp 5'-repressor element and regulates expression of the 5-hydroxytryptamine (serotonin) receptor 1A gene in neuronal cells. The DNA binding and transcriptional repressor activities

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CC2D1A