CBS Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: CBS Antibody [NBP1-83255] - Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoli & vesicles.
Immunohistochemistry-Paraffin: CBS Antibody [NBP1-83255] - Staining of human skeletal muscle shows no positivity in striated muscle fibers as expected.
Immunohistochemistry-Paraffin: CBS Antibody [NBP1-83255] - Staining of human liver shows moderate cytoplasmic positivity in hepatocytes.
Immunohistochemistry-Paraffin: CBS Antibody [NBP1-83255] - Staining of human pancreas shows moderate cytoplasmic positivity in exocrine glandular cells.
Immunohistochemistry-Paraffin: CBS Antibody [NBP1-83255] - Staining of human cerebellum shows moderate cytoplasmic positivity in a subset of cells in granular layer, as well as in neuropil of molecular layer.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CBS Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:GGSVKDRISLRMIEDAERDGTLKPGDTIIEPTSGNTGIGLALAAAVRGYRCIIVMPEKMSSEKVDVLRALGAEIVRTPTNARFDSPESHVGVAWRLKNEIPNSHILDQYRNASNPLAHYDTTADEILQQCDGKLDMLVASVGTGGTITGIGAPHR
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (92%), Rat (92%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CBS
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Theoretical MW
61 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Positive Control
Liver Lysate (NB820-59232)
Control Peptide
CBS Protein (NBP1-83255PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for CBS Antibody

  • cystathionine-beta-synthase
  • EC 4.2.1.2210Beta-thionase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-37607
Species: Hu, Rt
Applications: WB, ELISA, IHC
H00001491-M01
Species: Hu, GP
Applications: WB, ELISA
NB100-791
Species: Hu
Applications: WB, IHC, PEP-ELISA
NBP1-84037
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-57749
Species: Hu
Applications: WB, IHC
AF1640
Species: Hu
Applications: WB, IHC, ELISA(Cap), ELISA(Det), ELISA(Sta)
AF4309
Species: Hu, Mu
Applications: WB, IHC, ICC
NBP1-88927
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-89396
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF5724
Species: Hu, Mu, Rt
Applications: WB, ICC
NBP2-27461
Species: Hu, Mu, Rt
Applications: WB, PEP-ELISA
NBP1-87781
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-02349
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-00178
Species: Mu
Applications: WB, IHC, IHC-Fr, IHC-P, PEP-ELISA
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE

Publications for CBS Antibody (NBP1-83255) (0)

There are no publications for CBS Antibody (NBP1-83255).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CBS Antibody (NBP1-83255) (0)

There are no reviews for CBS Antibody (NBP1-83255). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for CBS Antibody (NBP1-83255) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Positive Control Lysate(s)

Secondary Antibodies

 

Isotype Controls

Additional CBS Products

Bioinformatics Tool for CBS Antibody (NBP1-83255)

Discover related pathways, diseases and genes to CBS Antibody (NBP1-83255). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CBS Antibody (NBP1-83255)

Discover more about diseases related to CBS Antibody (NBP1-83255).
 

Pathways for CBS Antibody (NBP1-83255)

View related products by pathway.

PTMs for CBS Antibody (NBP1-83255)

Learn more about PTMs related to CBS Antibody (NBP1-83255).
 

Research Areas for CBS Antibody (NBP1-83255)

Find related products by research area.

Blogs on CBS

There are no specific blogs for CBS, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CBS Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CBS
Entrez
Uniprot