CBL Antibody

Images

 
Western Blot: CBL Antibody [NBP1-86588] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells) Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)
Immunocytochemistry/ Immunofluorescence: CBL Antibody [NBP1-86588] - Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol.
Immunohistochemistry-Paraffin: CBL Antibody [NBP1-86588] - Staining of human tonsil shows strong cytoplasmic positivity in reaction center cells.
Western Blot: CBL Antibody [NBP1-86588] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-103
Immunohistochemistry-Paraffin: CBL Antibody [NBP1-86588] - Staining of human tonsil shows strong cytoplasmic positivity in reaction center cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CBL Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:PTTNVTEGSQVPERPPKPFPRRINSERKAGSCQQGSGPAASAATASPQLSSEIENLMSQGYSYQDIQKALVIAQNNIEMAKNILREFVSISSPAHVA
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CBL
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
CBL Protein (NBP1-86588PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (83%), Rat (84%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for CBL Antibody

  • Cas-Br-M (murine) ecotropic retroviral transforming sequence
  • Casitas B-lineage lymphoma proto-oncogene
  • CBL
  • CBL2
  • CBL2E3 ubiquitin-protein ligase CBL
  • EC 6.3.2
  • EC 6.3.2.-
  • oncogene CBL2
  • Proto-oncogene c-Cbl
  • RING finger protein 55
  • RNF55
  • RNF55C-CBL
  • Signal transduction protein CBL

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
AF2685
Species: Hu
Applications: WB, Simple Western, IHC
MAB38461
Species: Hu
Applications: WB, IHC
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
H00006464-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, PLA
AF7895
Species: Hu
Applications: WB, IHC
NBP1-85614
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-32945
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-31302
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88650
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-89150
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
H00011026-M01
Species: Hu
Applications: WB, ELISA
NBP1-59068
Species: Hu
Applications: WB
NBP2-21037
Species: Hu
Applications: WB, IHC, IHC-P
AF2988
Species: Mu, Rt
Applications: WB
NBP1-81988
Species: Hu
Applications: IHC, IHC-P

Publications for CBL Antibody (NBP1-86588) (0)

There are no publications for CBL Antibody (NBP1-86588).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CBL Antibody (NBP1-86588) (0)

There are no reviews for CBL Antibody (NBP1-86588). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for CBL Antibody (NBP1-86588) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CBL Products

Bioinformatics Tool for CBL Antibody (NBP1-86588)

Discover related pathways, diseases and genes to CBL Antibody (NBP1-86588). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CBL Antibody (NBP1-86588)

Discover more about diseases related to CBL Antibody (NBP1-86588).
 

Pathways for CBL Antibody (NBP1-86588)

View related products by pathway.

PTMs for CBL Antibody (NBP1-86588)

Learn more about PTMs related to CBL Antibody (NBP1-86588).
 

Research Areas for CBL Antibody (NBP1-86588)

Find related products by research area.

Blogs on CBL.

CD19: An Undoubted Biomarker for B Cells
CD19 is a cell surface protein member of the large immunoglobulin superfamily that complexes with CD21, CD81, and CD225 in the membrane of mature B-cells. A major function of CD19 is to assemble with the antigen receptor of B-lymphocytes to decrease t...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CBL Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CBL
Entrez