CBARA1 Antibody

Images

 
Genetic Strategies: Western Blot: CBARA1 Antibody [NBP2-58173] - Analysis in A-549 cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-MICU1 antibody. Remaining relative ...read more
Immunocytochemistry/ Immunofluorescence: CBARA1 Antibody [NBP2-58173] - Staining of human cell line A549 shows localization to mitochondria. Antibody staining is shown in green.
Western Blot: CBARA1 Antibody [NBP2-58173] - Analysis in human cell line CAPAN-2.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, KD
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
     

Genetic Strategies

   

Order Details

CBARA1 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: IFYTLGECGLISFSDYIFLTTVLSTPQRNFEIAFKMFDLNGDGEVDMEEFEQVQSIIRSQTSMGMRHRDRPTTGNTLKSGLCSALTTY
Specificity
Specificity of human CBARA1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (99%), Rat (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MICU1
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Knockdown Validated
Application Notes
ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
CBARA1 Recombinant Protein Antigen (NBP2-58173PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for CBARA1 Antibody

  • Allergen Hom s 4
  • ara CALC
  • Atopy-related autoantigen CALC
  • CALCDKFZp564C246
  • calcium binding atopy-related autoantigen 1
  • Calcium-binding atopy-related autoantigen 1
  • MICU1mitochondrial
  • mitochondrial calcium uptake 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB120-14817
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, S-ELISA
NBP1-88534
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, KD
AF1052
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready
NBP1-32870
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP, KD
NBP1-47602
Species: Hu, Mu, Bv, Vb
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP1-58359
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-15104
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF5866
Species: Hu
Applications: WB, IHC
H00003954-M03
Species: Hu, Mu
Applications: WB, ELISA, Func, ICC/IF, IHC, IHC-P, IP, S-ELISA
NBP2-76827
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-67656
Species: Hu, Mu, Rt, Ze
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NB100-59742
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, PEP-ELISA
NBP2-67233
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB600-41532
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB200-541
Species: Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IP
NBP2-58173
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, KD

Publications for CBARA1 Antibody (NBP2-58173) (0)

There are no publications for CBARA1 Antibody (NBP2-58173).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CBARA1 Antibody (NBP2-58173) (0)

There are no reviews for CBARA1 Antibody (NBP2-58173). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for CBARA1 Antibody (NBP2-58173) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional CBARA1 Products

Bioinformatics Tool for CBARA1 Antibody (NBP2-58173)

Discover related pathways, diseases and genes to CBARA1 Antibody (NBP2-58173). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CBARA1 Antibody (NBP2-58173)

Discover more about diseases related to CBARA1 Antibody (NBP2-58173).
 

Pathways for CBARA1 Antibody (NBP2-58173)

View related products by pathway.

PTMs for CBARA1 Antibody (NBP2-58173)

Learn more about PTMs related to CBARA1 Antibody (NBP2-58173).

Blogs on CBARA1

There are no specific blogs for CBARA1, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CBARA1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MICU1