CCDC109A Antibody

Images

 
Western Blot: CCDC109A Antibody [NBP1-88534] - Analysis in A-549 cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-MCU antibody. Remaining relative intensity is presented. Loading ...read more
Immunocytochemistry/ Immunofluorescence: CCDC109A Antibody [NBP1-88534] - Immunofluorescent staining of human cell line U-2 OS shows localization to mitochondria.
Immunohistochemistry-Paraffin: CCDC109A Antibody [NBP1-88534] - Immunohistochemical staining of human hippocampus shows moderate to strong granular cytoplasmic positivity in neurons.
Western Blot: CCDC109A Antibody [NBP1-88534] - Analysis in human cell line A-549.
Immunohistochemistry-Paraffin: CCDC109A Antibody [NBP1-88534] - Immunohistochemical staining of human colon shows strong granular cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: CCDC109A Antibody [NBP1-88534] - Immunohistochemical staining of human small intestine shows moderate to strong granular cytoplasmic positivity in glandular cells.
Simple Western: CCDC109A Antibody [NBP1-88534] - Simple Western lane view shows a specific band for MCU in 0.2 mg/ml of RT-4 (left), A549 (right) lysate. This experiment was performed under reducing conditions using the ...read more
Simple Western: CCDC109A Antibody [NBP1-88534] - Electropherogram image(s) of corresponding Simple Western lane view. CCDC109A antibody was used at 1:20 dilution on RT-4 and A549 lysate(s).

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, Simple Western, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CCDC109A Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:HHRTVHQRIASWQNLGAVYCSTVVPSDDVTVVYQNGLPVISVRLPSRRERCQFTLKPISDSVGVFLRQLQEEDRGIDRVAIYSPDGVRVAASTGIDLLLLDDFKLV
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (94%), Rat (94%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MCU
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Simple Western 1:20
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:50-1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

In Simple Western only 10 - 15 uL of the recommended dilution is used per data point. Separated by Size-Wes, Sally Sue/Peggy Sue.
Control Peptide
CCDC109A Protein (NBP1-88534PEP)
Publications
Read Publications using
NBP1-88534 in the following applications:

  • WB
    3 publications

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23774321)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for CCDC109A Antibody

  • C10orf42
  • coiled-coil domain containing 109A
  • coiled-coil domain-containing protein 109A
  • FLJ46135

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-86663
Species: Hu
Applications: WB, Simple Western, IHC, IHC-P
NBP2-50179
Species: Hu
Applications: WB, Flow, Func, ICC/IF, IP, CyTOF-ready
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
AF4937
Species: Hu
Applications: WB, IHC
NB100-41398
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
NB100-56311
Species: Hu
Applications: WB, ICC/IF, IHC-P
MAB7475
Species: Hu, Rt
Applications: WB
H00005250-B02P
Species: Hu
Applications: WB, ICC/IF
NBP2-15447
Species: Hu
Applications: WB
NBP1-28566
Species: Hu, Mu, Rt, Bv, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IP
NB100-56503
Species: Hu, Mu, Rt, Po, Ca, Dr, Eq, Ma, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-52582
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, CyTOF-ready
NB100-56703
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr
NBP2-06255
Species: Hu
NB100-56708
Species: Hu, Mu, Rt, Po, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready
H00003954-M03
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, IP
NBP1-88534
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P

Publications for CCDC109A Antibody (NBP1-88534)(8)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: WB.


Filter By Application
WB
(3)
All Applications
Filter By Species
Human
(2)
All Species
Showing Publications 1 - 8 of 8.
Publications using NBP1-88534 Applications Species
Lee Y, Min CK, Kim TG et al. Structure and function of the N-terminal domain of the human mitochondrial calcium uniporter. EMBO Rep 2015 Oct [PMID: 26341627] (WB, Human) WB Human
Arruda AP, Pers BM, Parlakgul G et al. Chronic enrichment of hepatic endoplasmic reticulum-mitochondria contact leads to mitochondrial dysfunction in obesity. Nature Medicine 2014 [PMID: 25419710] (WB, Human) WB Human
Kovacs-Bogdan E, Sancak Y, Kamer KJ et al. Reconstitution of the mitochondrial calcium uniporter in yeast. Proc Natl Acad Sci U S A 2014 Jun 17 [PMID: 24889638]
Stauch KL, Purnell PR, Fox HS. Quantitative Proteomics of Synaptic and Nonsynaptic Mitochondria: Insights for Synaptic Mitochondrial Vulnerability. J Proteome Res 2014 May 2 [PMID: 24708184] (WB) WB
Logan CV, Szabadkai G, Sharpe JA et al. Loss-of-function mutations in MICU1 cause a brain and muscle disorder linked to primary alterations in mitochondrial calcium signaling. Nat Genet 2014 Feb [PMID: 24336167]
Pan X, Liu J, Nguyen T et al. The physiological role of mitochondrial calcium revealed by mice lacking the mitochondrial calcium uniporter. Nat Cell Biol 2013 Dec [PMID: 24212091]
Qiu J, Tan YW, Hagenston AM et al. Mitochondrial calcium uniporter Mcu controls excitotoxicity and is transcriptionally repressed by neuroprotective nuclear calcium signals. Nat Commun 2013 [PMID: 23774321]
Baughman JM, Perocchi F, Girgis HS et al. Integrative genomics identifies MCU as an essential component of the mitochondrial calcium uniporter. Nature 2011 Jun [PMID: 21685886]

Reviews for CCDC109A Antibody (NBP1-88534) (0)

There are no reviews for CCDC109A Antibody (NBP1-88534). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for CCDC109A Antibody (NBP1-88534) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CCDC109A Products

Bioinformatics Tool for CCDC109A Antibody (NBP1-88534)

Discover related pathways, diseases and genes to CCDC109A Antibody (NBP1-88534). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CCDC109A Antibody (NBP1-88534)

Discover more about diseases related to CCDC109A Antibody (NBP1-88534).
 

Pathways for CCDC109A Antibody (NBP1-88534)

View related products by pathway.

PTMs for CCDC109A Antibody (NBP1-88534)

Learn more about PTMs related to CCDC109A Antibody (NBP1-88534).

Blogs on CCDC109A

There are no specific blogs for CCDC109A, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CCDC109A Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MCU
Entrez