CCDC109A Antibody

Western Blot: CCDC109A Antibody [NBP1-88534] - Analysis in A-549 cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-MCU antibody. Remaining relative intensity is presented. Loading control: Anti-PPIB.

Immunohistochemistry-Paraffin: CCDC109A Antibody [NBP1-88534] - Staining of human testis shows strong granular cytoplasmic positivity in cells in seminiferous ducts.

Immunohistochemistry-Paraffin: CCDC109A Antibody [NBP1-88534] - Immunohistochemical staining of human colon shows strong granular cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: CCDC109A Antibody [NBP1-88534] - Immunohistochemical staining of human small intestine shows moderate to strong granular cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: CCDC109A Antibody [NBP1-88534] - Immunohistochemical staining of human hippocampus shows moderate to strong granular cytoplasmic positivity in neurons.

Simple Western: CCDC109A Antibody [NBP1-88534] - Simple Western lane view shows a specific band for MCU in 0.2 mg/ml of RT-4 (left), A549 (right) lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation system.

Simple Western: CCDC109A Antibody [NBP1-88534] - Electropherogram image(s) of corresponding Simple Western lane view. CCDC109A antibody was used at 1:20 dilution on RT-4 and A549 lysate(s).

• Reactivity: Hu, Mu, Rt
• Applications: WB, Simple Western, IHC, Mycoplasma
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

CCDC109A Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: HHRTVHQRIASWQNLGAVYCSTVVPSDDVTVVYQNGLPVISVRLPSRRERCQFTLKPISDSVGVFLRQLQEEDRGIDRVAIYSPDGVRVAASTGIDLLLLDDFKLV
• Predicted Species: Mouse (94%), Rat (94%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: MCU
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Knockdown Validated
  • Simple Western 1:20
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
  
  In Simple Western only 10 - 15 uL of the recommended dilution is used per data point. Separated by Size-Wes, Sally Sue/Peggy Sue.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23774321)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for CCDC109A Antibody

• C10orf42
• CCDC109A
• coiled-coil domain containing 109A
• coiled-coil domain-containing protein 109A
• FLJ46135
• HsMCU
• MCU

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for CCDC109A Antibody (NBP1-88534)(8)

Publications using NBP1-88534

• Lee Y, Min CK, Kim TG et al. Structure and function of the N-terminal domain of the human mitochondrial calcium uniporter. EMBO Rep 2015-10-01 [PMID: 26341627] (WB, Human)
• Arruda AP, Pers BM, Parlakgul G et al. Chronic enrichment of hepatic endoplasmic reticulum-mitochondria contact leads to mitochondrial dysfunction in obesity. Nature Medicine 2014-01-01 [PMID: 25419710] (WB, Human)
• Kovacs-Bogdan E, Sancak Y, Kamer KJ et al. Reconstitution of the mitochondrial calcium uniporter in yeast. Proc Natl Acad Sci U S A 2014-06-17 [PMID: 24889638]
• Stauch KL, Purnell PR, Fox HS. Quantitative Proteomics of Synaptic and Nonsynaptic Mitochondria: Insights for Synaptic Mitochondrial Vulnerability. J Proteome Res 2014-05-02 [PMID: 24708184] (WB)
• Logan CV, Szabadkai G, Sharpe JA et al. Loss-of-function mutations in MICU1 cause a brain and muscle disorder linked to primary alterations in mitochondrial calcium signaling. Nat Genet 2014-02-01 [PMID: 24336167]
• Pan X, Liu J, Nguyen T et al. The physiological role of mitochondrial calcium revealed by mice lacking the mitochondrial calcium uniporter. Nat Cell Biol 2013-12-01 [PMID: 24212091]
• Qiu J, Tan YW, Hagenston AM et al. Mitochondrial calcium uniporter Mcu controls excitotoxicity and is transcriptionally repressed by neuroprotective nuclear calcium signals. Nat Commun 2013-01-01 [PMID: 23774321]
• Baughman JM, Perocchi F, Girgis HS et al. Integrative genomics identifies MCU as an essential component of the mitochondrial calcium uniporter. Nature 2011-06-01 [PMID: 21685886]

Bioinformatics

• Gene Symbol: MCU
• Entrez:
  • 90550(Human)