LETM1 Antibody (6F7)

Images

 
Western Blot: LETM1 Antibody (6F7) [H00003954-M03] - Analysis of LETM1 expression in transfected 293T cell line by LETM1 monoclonal antibody (M03), clone 6F7. Lane 1: LETM1 transfected lysatE (83.4 KDa). Lane 2: ...read more
Immunocytochemistry/ Immunofluorescence: LETM1 Antibody (6F7) [H00003954-M03] - Analysis of monoclonal antibody to LETM1 on HeLa cell. Antibody concentration 10 ug/ml
Immunohistochemistry-Paraffin: LETM1 Antibody (6F7) [H00003954-M03] - Analysis of monoclonal antibody to LETM1 on formalin-fixed paraffin-embedded human small Intestine. Antibody concentration 3 ug/ml
Western Blot: LETM1 Antibody (6F7) [H00003954-M03] - Analysis of LETM1 expression in HeLa (Cat # L013V1).
ELISA: LETM1 Antibody (6F7) [H00003954-M03] - Detection limit for recombinant GST tagged LETM1 is approximately 0.03ng/ml as a capture antibody.
Immunoprecipitation: LETM1 Antibody (6F7) [H00003954-M03] - Analysis of LETM1 transfected lysate using anti-LETM1 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with LETM1 rabbit polyclonal antibody.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB, ELISA, Func, ICC/IF, IHC, IHC-P, IP
Clone
6F7
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

LETM1 Antibody (6F7) Summary

Immunogen
LETM1 (NP_036450, 601 a.a. ~ 708 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. ESKASKRLTKRVQQMIGQIDGLISQLEMDQQAGKLAPANGMPTGENVISVAELINAMKQVKHIPESKLTSLAAALDENKDGKVNIDDLVKVIELVDKEDVHISTSQVA
Specificity
LETM1 - leucine zipper-EF-hand containing transmembrane protein 1
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
LETM1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Functional
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Immunoprecipitation
  • Western Blot 1:500
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for IF, IHC-P and ELISA.
Publications
Read Publications using H00003954-M03.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for LETM1 Antibody (6F7)

  • LETM1 and EF-hand domain-containing protein 1, mitochondrial
  • leucine zipper-EF-hand containing transmembrane protein 1
  • Leucine zipper-EF-hand-containing transmembrane protein 1
  • Mdm38 homolog

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-52963
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-86663
Species: Hu, Mu
Applications: IHC, IHC-P, Simple Western, WB
NBP3-04759
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-37394
Species: Hu, Rt
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, WB
NBP1-77360
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NBP2-67627
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
AF887
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
NB100-59742
Species: Hu, Mu, Rt
Applications: ICC/IF, PEP-ELISA, WB
H00007109-M01
Species: Hu
Applications: ELISA, KD, WB
NBP1-88534
Species: Hu
Applications: IHC, IHC-P, KD, Simple Western, WB
NBP1-88564
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-20119
Species: Hu, Mu
Applications: IHC, IHC-P, WB
NBP1-85500
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
NBP1-83563
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
H00080024-P01
Species: Hu
Applications: ELISA, AP, PA, WB
NBP2-02619
Species: Hu, Pm, Pm
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP1-84671
Species: Hu
Applications: IHC, IHC-P, WB
H00005018-D01P
Species: Hu
Applications: ICC/IF, WB

Publications for LETM1 Antibody (H00003954-M03)(8)


Showing Publications 1 - 8 of 8.
Publications using H00003954-M03 Applications Species
Yang Z, Ni W, Cui C et al. Identification of LETM1 as a marker of cancer stem-like cells and predictor of poor prognosis in esophageal squamous cell carcinoma. Hum Pathol Jul 18 2018 [PMID: 30031102]
Li N, Zheng Y, Xuan C et al. LETM1 overexpression is correlated with the clinical features and survival outcome of breast cancer. Int J Clin Exp Pathol Oct 15 2015 [PMID: 26722481]
Doonan PJ, Chandramoorthy HC, Hoffman NE et al. LETM1-dependent mitochondrial Ca2+ flux modulates cellular bioenergetics and proliferation. FASEB J. 2014 Jul 30 [PMID: 25077561]
Chen L, Yang Y, Liu S et al. High Expression of Leucine Zipper-EF-Hand Containing Transmembrane Protein 1 Predicts Poor Prognosis in Head and Neck Squamous Cell Carcinoma. BioMed Research International. 2014 [PMID: 24689060]
Shin JY, Chung YS, Kang B et al. Co-delivery of LETM1 and CTMP synergistically inhibits tumor growth in H-ras12V liver cancer model mice. Cancer Gene Ther. 2013 Feb 08 [PMID: 23392203]
Piao L, Li Y, Kim SJ et al. Association of LETM1 MRPL36 Contributes to the Regulation of Mitochondrial ATP Production Necrotic Cell Death. Cancer Res 69(8):3397-404. 2009 Apr 15. [PMID: 19318571]
Piao L, Li Y, Kim SJ et al. Regulation of OPA1-mediated mitochondrial fusion by Leucine zipper/EF-h-containing transmembrane protein-1 plays a role in apoptosis. Cell Signal 21(5):767-77. 2009 May. [PMID: 19168126]
Dimmer KS, Navoni F, Casarin A et al. LETM1, deleted in Wolf Hirschhorn syndrome is required for normal mitochondrial morphology and cellular viability. Hum Mol Genet. 2008 Jan 15 [PMID: 17925330]

Reviews for LETM1 Antibody (H00003954-M03) (0)

There are no reviews for LETM1 Antibody (H00003954-M03). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for LETM1 Antibody (H00003954-M03) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional LETM1 Products

Bioinformatics Tool for LETM1 Antibody (H00003954-M03)

Discover related pathways, diseases and genes to LETM1 Antibody (H00003954-M03). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for LETM1 Antibody (H00003954-M03)

Discover more about diseases related to LETM1 Antibody (H00003954-M03).
 

Pathways for LETM1 Antibody (H00003954-M03)

View related products by pathway.

PTMs for LETM1 Antibody (H00003954-M03)

Learn more about PTMs related to LETM1 Antibody (H00003954-M03).

Blogs on LETM1

There are no specific blogs for LETM1, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our LETM1 Antibody (6F7) and receive a gift card or discount.

Bioinformatics

Gene Symbol LETM1
Entrez
OMIM
Uniprot