Recombinant Human Caveolin-1 GST (N-Term) Protein

Images

 
SDS-Page: Recombinant Human Caveolin-1 Protein [H00000857-P01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human Caveolin-1 GST (N-Term) Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1-178 of Human CAV1 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MSGGKYVDSEGHLYTVPIREQGNIYKPNNKAMADELSEKQVYDAHTKEIDLVNRDPKHLNDDVVKIDFEDVIAEPEGTHSFDGIWKASFTTFTVTKYWFYRLLSALFGIPMALIWGIYFAILSFLHIWAVVPCIKSFLIEIQCISRVYSIYVHTVCDPLFEAVGKIFSNVRINLQKEI

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Full Length Recombinant Protein
Gene
CAV1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
Theoretical MW
45.21 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Publications
Read Publications using H00000857-P01.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Caveolin-1 GST (N-Term) Protein

  • CAV
  • CAV1
  • caveolae protein, 22kD
  • caveolin 1, caveolae protein, 22kDa
  • Caveolin1
  • Caveolin-1
  • cell growth-inhibiting protein 32
  • MSTP085
  • VIP21

Background

The scaffolding protein encoded by this gene is the main component of the caveolae plasma membranes found in most cell types. The protein links integrin subunits to the tyrosine kinase FYN, an initiating step in coupling integrins to the Ras-ERK pathway and promoting cell cycle progression. The gene is a tumor suppressor gene candidate and a negative regulator of the Ras-p42/44 MAP kinase cascade. CAV1 and CAV2 are located next to each other on chromosome 7 and express colocalizing proteins that form a stable hetero-oligomeric complex. By using alternative initiation codons in the same reading frame, two isoforms (alpha and beta) are encoded by a single transcript from this gene. CAV1( AAH09685, 1 a.a. - 179 a.a.) recombinant protein with GST.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-31116
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
NB300-500
Species: Am, Bv, Ca, Dr, Hu, Mu, Po, Rt, Sh
Applications: IHC, IHC-Fr, IHC-P, WB
NB110-5029
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
NBP2-22203
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
NBP2-67360
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, KO, WB
AF887
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
AF2685
Species: Hu
Applications: IHC, Simple Western, WB
AF231
Species: Hu
Applications: CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, Simple Western, WB
NBP1-76919
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NB300-605
Species: Hu, Mu, Po, Rt
Applications: Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, WB
DVE00
Species: Hu
Applications: ELISA
236-EG
Species: Hu
Applications: BA
NB100-858
Species: Gp, Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC-WhMt, IHC, IHC-Fr, IHC-P, PEP-ELISA, WB
AF467
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB
MAB1417
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
210-TA
Species: Hu
Applications: BA
AF1347
Species: Hu, Mu, Rt
Applications: ICC, IHC, Simple Western, WB
NBP2-29463
Species: Pm, Hu, Pm, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, WB

Publications for Caveolin-1 Recombinant Protein (H00000857-P01)(6)

Reviews for Caveolin-1 Recombinant Protein (H00000857-P01) (0)

There are no reviews for Caveolin-1 Recombinant Protein (H00000857-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Caveolin-1 Recombinant Protein (H00000857-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Caveolin-1 Products

Bioinformatics Tool for Caveolin-1 Recombinant Protein (H00000857-P01)

Discover related pathways, diseases and genes to Caveolin-1 Recombinant Protein (H00000857-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Caveolin-1 Recombinant Protein (H00000857-P01)

Discover more about diseases related to Caveolin-1 Recombinant Protein (H00000857-P01).
 

Pathways for Caveolin-1 Recombinant Protein (H00000857-P01)

View related products by pathway.

PTMs for Caveolin-1 Recombinant Protein (H00000857-P01)

Learn more about PTMs related to Caveolin-1 Recombinant Protein (H00000857-P01).
 

Research Areas for Caveolin-1 Recombinant Protein (H00000857-P01)

Find related products by research area.

Blogs on Caveolin-1

There are no specific blogs for Caveolin-1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Caveolin-1 GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol CAV1