Recombinant Human Caveolin-1 GST (N-Term) Protein

SDS-Page: Recombinant Human Caveolin-1 Protein [H00000857-P01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

• Reactivity: Hu
• Applications: WB, ELISA, MA, AP

Recombinant Human Caveolin-1 GST (N-Term) Protein Summary

• Description: A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-178 of Human CAV1
  
  

  Source: Wheat Germ (in vitro)

  Amino Acid Sequence: MSGGKYVDSEGHLYTVPIREQGNIYKPNNKAMADELSEKQVYDAHTKEIDLVNRDPKHLNDDVVKIDFEDVIAEPEGTHSFDGIWKASFTTFTVTKYWFYRLLSALFGIPMALIWGIYFAILSFLHIWAVVPCIKSFLIEIQCISRVYSIYVHTVCDPLFEAVGKIFSNVRINLQKEI

• Preparation Method: in vitro wheat germ expression system
• Details of Functionality: This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
• Source: Wheat germ
• Protein/Peptide Type: Recombinant Protein
• Gene: CAV1
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
• Theoretical MW: 45.21 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -80C. Avoid freeze-thaw cycles.
• Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Caveolin-1 GST (N-Term) Protein

• CAV
• CAV1
• caveolae protein, 22kD
• caveolin 1, caveolae protein, 22kDa
• Caveolin1
• Caveolin-1
• cell growth-inhibiting protein 32
• MSTP085
• VIP21

Background

The scaffolding protein encoded by this gene is the main component of the caveolae plasma membranes found in most cell types. The protein links integrin subunits to the tyrosine kinase FYN, an initiating step in coupling integrins to the Ras-ERK pathway and promoting cell cycle progression. The gene is a tumor suppressor gene candidate and a negative regulator of the Ras-p42/44 MAP kinase cascade. CAV1 and CAV2 are located next to each other on chromosome 7 and express colocalizing proteins that form a stable hetero-oligomeric complex. By using alternative initiation codons in the same reading frame, two isoforms (alpha and beta) are encoded by a single transcript from this gene. CAV1( AAH09685, 1 a.a. - 179 a.a.) recombinant protein with GST.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Publications for Caveolin-1 Recombinant Protein (H00000857-P01)(6)

Publications using H00000857-P01

• Hiromura M, Nohtomi K, Mori Y et al. Caveolin-1, a binding protein of CD26, is essential for the anti-inflammatory effects of dipeptidyl peptidase-4 inhibitors on human and mouse macrophages. Biochem Biophys Res Commun 2017-11-04 [PMID: 29113797]
• Hossain MB, Shifat R, Li J et al. TIE2 associates with caveolae and regulates caveolin-1 to promote their nuclear translocation Mol. Cell. Biol. 2017-07-31 [PMID: 28760776] (Human)
• Kastelijn EA, van Moorsel CH, Kazemier KM et al. A genetic polymorphism in the CAV1 gene associates with the development of bronchiolitis obliterans syndrome after lung transplantation. Fibrogenesis Tissue Repair. 2011-11-01 [PMID: 22040717]
• Bruyere C, Abeloos L, Lamoral-Theys D et al. Temozolomide modifies caveolin-1 expression in experimental malignant gliomas in vitro and in vivo. Transl Oncol. 2011-04-01 [PMID: 21461172]
• Xia H, Khalil W, Kahm J et al. Pathologic Caveolin-1 Regulation of PTEN in Idiopathic Pulmonary Fibrosis. Am J Pathol. 2010-04-15 [PMID: 20395445]
• Sawada S, Ishikawa C, Tanji H et al. Overexpression of caveolin-1 in adult T-cell leukemia. Blood;115(11):2220-30. 2010-03-18 [PMID: 20061557]

Bioinformatics

• Gene Symbol: CAV1