Cav3.2 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: Cav3.2 Antibody [NBP1-88176] - Staining of human cell line A549 shows localization to nucleoplasm & vesicles.
Immunohistochemistry-Paraffin: Cav3.2 Antibody [NBP1-88176] - Staining of human testis shows cytoplasmic positivity in Leydig cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Cav3.2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:EEVSHITSSACPWQPTAEPHGPEASPVAGGERDLRRLYSVDAQGFLDKPGRADEQWRPSAELGSGEPGEAKAWGPEAEPALGARRKKKMSP
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CACNA1H
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Cav3.2 Protein (NBP1-88176PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Cav3.2 Antibody

  • CACNA1HB
  • calcium channel, voltage-dependent, T type, alpha 1H subunit
  • calcium channel, voltage-dependent, T type, alpha 1Hb subunit
  • Cav3.2
  • ECA6
  • EIG6
  • FLJ90484
  • Low-voltage-activated calcium channel alpha1 3.2 subunit
  • low-voltage-activated calcium channel alpha13.2 subunit
  • voltage dependent t-type calcium channel alpha-1H subunit
  • voltage-dependent T-type calcium channel subunit alpha-1H
  • voltage-gated calcium channel alpha subunit Cav3.2
  • voltage-gated calcium channel alpha subunit CavT.2
  • Voltage-gated calcium channel subunit alpha Cav3.2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-59322
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
NBP1-30674
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-22439
Species: Hu, Mu, Rb
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB100-757
Species: Hu
Applications: WB, IHC-P
NBP1-91744
Species: Hu
Applications: IHC, IHC-P
NBP2-38049
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-1533
Species: Hu, Mu, Po, Sh
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
H00001958-M03
Species: Hu, Rb
Applications: WB, ELISA, ICC/IF, IHC-P
NBP1-00175
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
H00000777-R01
Species: Hu
NB110-5029
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NB100-65214
Species: Hu, Mu, Rt, Ma
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
H00010411-D01P
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF
NBP1-30027
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
MAB7447
Species: Hu
Applications: WB, IHC
H00006192-P01
Species: Hu

Publications for Cav3.2 Antibody (NBP1-88176) (0)

There are no publications for Cav3.2 Antibody (NBP1-88176).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Cav3.2 Antibody (NBP1-88176) (0)

There are no reviews for Cav3.2 Antibody (NBP1-88176). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for Cav3.2 Antibody (NBP1-88176) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Cav3.2 Products

Bioinformatics Tool for Cav3.2 Antibody (NBP1-88176)

Discover related pathways, diseases and genes to Cav3.2 Antibody (NBP1-88176). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Cav3.2 Antibody (NBP1-88176)

Discover more about diseases related to Cav3.2 Antibody (NBP1-88176).
 

Pathways for Cav3.2 Antibody (NBP1-88176)

View related products by pathway.

PTMs for Cav3.2 Antibody (NBP1-88176)

Learn more about PTMs related to Cav3.2 Antibody (NBP1-88176).

Blogs on Cav3.2

There are no specific blogs for Cav3.2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Cav3.2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CACNA1H