Cathepsin Z Antibody - BSA Free

Western Blot: Cathepsin Z Antibody [NBP2-87286] - WB Suggested Anti-Ctsz Antibody. Titration: 1.0 ug/ml. Positive Control: Mouse Heart

• Reactivity: Mu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

Cathepsin Z Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Cathepsin Z Antibody - BSA Free (NBP2-87286) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Cathepsin Z. Peptide sequence SAARARLYFRSGQTCYHPIRGDQLALLGRRTYPRPHEYLSPADLPKNWDW The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CTSZ
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for Cathepsin Z Antibody - BSA Free

• Cathepsin P
• Cathepsin X
• cathepsin Z
• CTSX
• EC 3.4.18.1
• FLJ17088
• preprocathepsin P

Background

Cathepsin Z is encoded by this gene is a lysosomal cysteine proteinase and member of the peptidase C1 family. It exhibits both carboxy-monopeptidase and carboxy-dipeptidase activities. The encoded protein has also been known as cathepsin X and cathepsin P. This gene is expressed ubiquitously in cancer cell lines and primary tumors and, like other members of this family, may be involved in tumorigenesis. At least two transcript variants of this gene have been found, but the full-length nature of only one of them has been determined.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CTSZ