Cathepsin X/Z/P Antibody - BSA Free

Western Blot: Cathepsin X/Z/P Antibody [NBP2-38614] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10Lane 2: Human cell line CACO-2

Immunocytochemistry/Immunofluorescence: Cathepsin X/Z/P Antibody [NBP2-38614] - Staining of human cell line A-431 shows localization to vesicles. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: Cathepsin X/Z/P Antibody [NBP2-38614] - Staining of human small intestine shows moderate cytoplasmic positivity in glandular cells.

Simple Western: Cathepsin X/Z/P Antibody [NBP2-38614] - Simple Western lane view shows a specific band for Cathepsin Z in 0.2 mg/ml of SW480 lysate(s). This experiment was performed under reducing conditions using the 12-230 kDa separation systems.

Simple Western: Cathepsin X/Z/P Antibody [NBP2-38614] - Electropherogram image of the corresponding Simple Western lane view. Cathepsin Z antibody was used at 1:10 dilution on SW480 lysate(s) respectively.

• Reactivity: Hu, Mu, Rt
• Applications: WB, Simple Western, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Cathepsin X/Z/P Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: PDETCNNYQAKDQECDKFNQCGTCNEFKECHAIRNYTLWRVGDYGSLSGREKMMAEIYANGPISCGIMATERLANYTGGIYAEYQD
• Predicted Species: Mouse (91%), Rat (92%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CTSZ
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Simple Western 1:10
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  Cathepsin Z Protein (NBP2-38614PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Cathepsin X/Z/P Antibody - BSA Free

• Cathepsin P
• Cathepsin X/Z/P
• Cathepsin Z
• CTSX
• CTSZ

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CTSZ
• Uniprot:
  • Q9UBR2()