Cathepsin W Antibody - BSA Free

Western Blot: Cathepsin W Antibody [NBP2-88778] - Host: Rabbit. Target Name: CTSW. Sample Tissue: Human A549 Whole Cell lysates. Antibody Dilution: 1ug/ml

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

Cathepsin W Antibody - BSA Free Summary

• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human Cathepsin W. Peptide sequence: WDFVDVSVQELLDCGRCGDGCHGGFVWDAFITVLNNSGLASEKDYPFQGK The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CTSW
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for Cathepsin W Antibody - BSA Free

• cathepsin W (lymphopain)
• cathepsin W
• EC 3.4.22.-
• lymphopain
• LYPN

Background

The protein encoded by the Cathepsin W gene, a member of the peptidase C1 family, is a cysteine proteinase that may have aspecific function in the mechanism or regulation of T-cell cytolytic activity. The encoded protein is found associatedwith the membrane inside the endoplasmic reticulum of natural killer and cytotoxic T-cells. Expression of this gene isup-regulated by interleukin-2. (provided by RefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CTSW