Cathepsin K Antibody (1B11)

Images

 
ELISA: Cathepsin K Antibody (1B11) [H00001513-M03] - Detection limit for recombinant GST tagged CTSK is approximately 3ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ELISA
Clone
1B11
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Cathepsin K Antibody (1B11) Summary

Immunogen
CTSK (AAH16058 220 a.a. - 329 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. KCRGYREIPEGNEKALKRAVARVGPVSVAIDASLTSFQFYSKGVYYDESCNSDNLNHAVLAVGYGIQKGNKHWIIKNSWGENWGNKGYILMARNKNNACGIANLASFPKM
Specificity
CTSK - cathepsin K (pycnodysostosis) (1B11)
Isotype
IgG2b Kappa
Clonality
Monoclonal
Host
Mouse
Gene
CTSK
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
Application Notes
Antibody reactivity against recombinant protein with GST tag on ELISA. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Cathepsin K Antibody (1B11)

  • cathepsin K (pycnodysostosis)
  • Cathepsin K
  • Cathepsin O
  • cathepsin O1
  • Cathepsin O2
  • Cathepsin X
  • CTS02
  • CTSK
  • CTSO
  • CTSO1
  • CTSO2
  • EC 3.4.22
  • EC 3.4.22.38
  • MGC23107
  • PKND
  • PYCD

Background

The protein encoded by this gene is a lysosomal cysteine proteinase involved in bone remodeling and resorption. This protein, which is a member of the peptidase C1 protein family, is predominantly expressed in osteoclasts. However, the encoded protein is also expressed in a significant fraction of human breast cancers, where it could contribute to tumor invasiveness. Mutations in this gene are the cause of pycnodysostosis, an autosomal recessive disease characterized by osteosclerosis and short stature. This gene may be subject to RNA editing. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF952
Species: Hu
Applications: WB, IHC, IP, ELISA(Cap), ELISA(Det), ELISA(Sta)
NB100-56508
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC, IHC-P, CyTOF-ready, Flow-CS
NB100-56505
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready
NBP2-45293
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, PAGE, IF
NB100-56715
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-87315
Species: Hu
Applications: IHC, IHC-P
H00057410-M02
Species: Hu, Mu, Rt
Applications: WB, ELISA
AF953
Species: Hu
Applications: WB, Simple Western, IHC, IP
AF1183
Species: Hu
Applications: WB, IHC, IP, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
MAB1419
Species: Hu, Rt
Applications: IHC, CyTOF-ready, ICC, ICFlow
NB100-56732
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF
MAB4614
Species: Hu
Applications: Flow, CyTOF-ready
NBP1-32870
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP
H00001513-M03
Species: Hu
Applications: ELISA

Publications for Cathepsin K Antibody (H00001513-M03) (0)

There are no publications for Cathepsin K Antibody (H00001513-M03).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Cathepsin K Antibody (H00001513-M03) (0)

There are no reviews for Cathepsin K Antibody (H00001513-M03). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Cathepsin K Antibody (H00001513-M03) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Cathepsin K Products

Bioinformatics Tool for Cathepsin K Antibody (H00001513-M03)

Discover related pathways, diseases and genes to Cathepsin K Antibody (H00001513-M03). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Cathepsin K Antibody (H00001513-M03)

Discover more about diseases related to Cathepsin K Antibody (H00001513-M03).
 

Pathways for Cathepsin K Antibody (H00001513-M03)

View related products by pathway.

PTMs for Cathepsin K Antibody (H00001513-M03)

Learn more about PTMs related to Cathepsin K Antibody (H00001513-M03).
 

Research Areas for Cathepsin K Antibody (H00001513-M03)

Find related products by research area.

Blogs on Cathepsin K

There are no specific blogs for Cathepsin K, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Cathepsin K Antibody (1B11) and receive a gift card or discount.

Bioinformatics

Gene Symbol CTSK
Entrez
Uniprot