Cathepsin E Antibody (2D5)

Images

 
Western Blot: Cathepsin E Antibody (2D5) [H00001510-M10] - Analysis of CTSE expression in transfected 293T cell line by CTSE monoclonal antibody (M10), clone 2D5. Lane 1: CTSE transfected lysate (Predicted MW: 42.8 ...read more
Sandwich ELISA: Cathepsin E Antibody (2D5) [H00001510-M10] - Detection limit for recombinant GST tagged CTSE is 1 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
2D5
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Cathepsin E Antibody (2D5) Summary

Immunogen
CTSE (AAH42537, 18 a.a. - 396 a.a.) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. QGSLHRVPLRRHPTLKKKLRARSQLSEFWKSHNLDMIQFTESCSMDQSAKEPLINYLDMEYFGTISIGSPPQNFTVIFDTGSSNLWVPSVYCTSPACKTHSRFQPSQSSTYSQPGQSFSIQYGTGSLSGIIGADQVSVEGLTVVGQQFGESVTEPGQTLVDAEFDGILGLGYPSLAVGGVTPVFDNMMAQNLVDLPMFSVYMSSNPEGGAGSELIFGGYDHSHFSGSLNWVPVTKQAYWQIALDNIQVGGTVMFCSEGCQAIVDTGTSLITGPSDKIKQLQNAIGAAPVDGEYAVECANLNVMPDVTFTINGVPYTLSPTAYTLLDFVDGMQFCSSGFQGLDIHPPAGPLWILGDVFIRQFYSVFDRGNNRVGLAPAVP
Specificity
CTSE (2D5)
Isotype
IgG2a
Clonality
Monoclonal
Host
Mouse
Gene
CTSE
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
It has been used for ELISA and WB.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Cathepsin E Antibody (2D5)

  • CATE
  • Cathepsin E
  • CTSE
  • EC 3.4.23
  • EC 3.4.23.34
  • erythrocyte membrane aspartic proteinase
  • slow-moving proteinase

Background

The protein encoded by this gene is a gastric aspartyl protease that functions as a disulfide-linked homodimer. This protease, which is a member of the peptidase C1 family, has a specificity similar to that of pepsin A and cathepsin D. It is an intracellular proteinase that does not appear to be involved in the digestion of dietary protein and is found in highest concentration in the surface of epithelial mucus-producing cells of the stomach. It is the first aspartic proteinase expressed in the fetal stomach and is found in more than half of gastric cancers. It appears, therefore, to be an oncofetal antigen. Transcript variants utilizing alternative polyadenylation signals and two transcript variants encoding different isoforms exist for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF1029
Species: Mu
Applications: WB, IHC, IP
NBP1-91012
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
AF4090
Species: Hu
Applications: WB, IHC, IP, Neut
NBP1-32108
Species: Hu, Rt
Applications: WB, ICC/IF
NBP2-45897
Species: Hu
Applications: WB, IHC
NBP1-32870
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP
AF953
Species: Hu
Applications: WB, Simple Western, IHC, IP
NB600-922
Species: Ch, Vi
Applications: WB, ELISA, IHC, IHC-P, IP
AF952
Species: Hu
Applications: WB, IHC, IP, ELISA(Cap), ELISA(Det), ELISA(Sta)
NBP2-22217
Species: Hu, Mu, Rt(-)
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-15104
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF5866
Species: Hu
Applications: WB, IHC
NB120-19294
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-30027
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00001510-M10
Species: Hu
Applications: WB, ELISA

Publications for Cathepsin E Antibody (H00001510-M10) (0)

There are no publications for Cathepsin E Antibody (H00001510-M10).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Cathepsin E Antibody (H00001510-M10) (0)

There are no reviews for Cathepsin E Antibody (H00001510-M10). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Cathepsin E Antibody (H00001510-M10) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Cathepsin E Products

Bioinformatics Tool for Cathepsin E Antibody (H00001510-M10)

Discover related pathways, diseases and genes to Cathepsin E Antibody (H00001510-M10). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Cathepsin E Antibody (H00001510-M10)

Discover more about diseases related to Cathepsin E Antibody (H00001510-M10).
 

Pathways for Cathepsin E Antibody (H00001510-M10)

View related products by pathway.

PTMs for Cathepsin E Antibody (H00001510-M10)

Learn more about PTMs related to Cathepsin E Antibody (H00001510-M10).
 

Research Areas for Cathepsin E Antibody (H00001510-M10)

Find related products by research area.

Blogs on Cathepsin E

There are no specific blogs for Cathepsin E, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Cathepsin E Antibody (2D5) and receive a gift card or discount.

Bioinformatics

Gene Symbol CTSE
Entrez
Uniprot