Cathepsin A/Lysosomal Carboxypeptidase A Recombinant Protein Antigen

Images

 
There are currently no images for Cathepsin A/Lysosomal Carboxypeptidase A Recombinant Protein Antigen (NBP3-21355PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Cathepsin A/Lysosomal Carboxypeptidase A Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Cathepsin A/Lysosomal Carboxypeptidase A

Source: E.coli

Amino Acid Sequence: PSMNLQGLAVGNGLSSYEQNDNSLVYFAYYHGLLGNRLWSSLQTHCCSQNKCNFYDNKDLECVTNLQEVARIVGNSGLNIYNLYAPCAGGVPSHFRYEKDTVVVQDLGNIFT

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
CTSA
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-21355. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com
Theoretical MW
30 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Cathepsin A/Lysosomal Carboxypeptidase A Recombinant Protein Antigen

  • beta-galactosidase 2
  • beta-galactosidase protective protein
  • Carboxypeptidase C
  • Carboxypeptidase L
  • Cathepsin A
  • cathepsin ANGBE
  • CTSA
  • EC 3.4.16
  • EC 3.4.16.5
  • GLB2
  • GSL
  • Lysosomal Carboxypeptidase A
  • lysosomal protective protein
  • PPCA
  • PPGBprotective protein for beta-galactosidase (galactosialidosis)
  • Protective protein cathepsin A
  • Protective protein for beta-galactosidase

Background

Lysosomal protective protein/cathepsin A (PPCA) is a lysosomal serine carboxypeptidase that forms an intralysosomal enzyme-complex with b-galactosidase and neuraminidase (NEU1). PPCA is synthesized as a 54-kDa precursor/zymogen, and proteolytically cleaved in the lysosome into a catalytically active 32- and 20-kDa two-chain enzyme. The enzyme has cathepsin A activity at acidic pH but maintains also a deamidase/esterase activity at neutral pH. Furthermore, the human enzyme, purified from platelets and lymphocytes, has been shown to function on the inactivation of selected neuropeptides, like substance P, oxytocin, and endothelin I. The autosomal recessive genetic deficiency of PPCA causes galactosialidosis, a neurodegenerative lysosomal storage disorder, resulting in the secondary deficiencies of b-galactosidase and NEU1.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-45731
Species: Ca, Hu, Pm
Applications: IHC,  IHC-P, WB
NBP1-88856
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
MAB6860
Species: Hu
Applications: IP, WB
H00007357-M03
Species: Hu
Applications: ELISA, WB
AF3638
Species: Hu
Applications: WB
NBP1-30027
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
AF1029
Species: Mu
Applications: ICC, IHC, IP, WB
AF1396
Species: Hu
Applications: WB
AF965
Species: Mu
Applications: IHC, Neut, WB
NBP1-81838
Species: Hu
Applications: IHC,  IHC-P, WB
7268-CT
Species: Hu
Applications: BA
NB110-41404
Species: Bv, Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
AF1513
Species: Mu
Applications: CyTOF-ready, Flow, IHC, IP, Simple Western, WB
NBP3-47902
Species: Hu, Mu, Rt
Applications: ELISA, IHC, WB
NB100-524
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
NBP2-79843
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC,  IHC-P, PA, WB
NB100-91662
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, Simple Western, WB
NBP1-62583
Species: Hu
Applications: WB

Publications for Cathepsin A/Lysosomal Carboxypeptidase A Recombinant Protein Antigen (NBP3-21355PEP) (0)

There are no publications for Cathepsin A/Lysosomal Carboxypeptidase A Recombinant Protein Antigen (NBP3-21355PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Cathepsin A/Lysosomal Carboxypeptidase A Recombinant Protein Antigen (NBP3-21355PEP) (0)

There are no reviews for Cathepsin A/Lysosomal Carboxypeptidase A Recombinant Protein Antigen (NBP3-21355PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Cathepsin A/Lysosomal Carboxypeptidase A Recombinant Protein Antigen (NBP3-21355PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Cathepsin A/Lysosomal Carboxypeptidase A Products

Research Areas for Cathepsin A/Lysosomal Carboxypeptidase A Recombinant Protein Antigen (NBP3-21355PEP)

Find related products by research area.

Blogs on Cathepsin A/Lysosomal Carboxypeptidase A

There are no specific blogs for Cathepsin A/Lysosomal Carboxypeptidase A, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Cathepsin A/Lysosomal Carboxypeptidase A Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol CTSA