CAT1 Antibody


Western Blot: CAT1 Antibody [NBP1-90066] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Negative control (vector only transfected HEK293T lysate)Lane 3: Over-expression lysate (Co-expressed with a more
Immunohistochemistry-Paraffin: CAT1 Antibody [NBP1-90066] - Staining of human small intestine shows strong membranous positivity in glandular cells.

Product Details

Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Order Details

CAT1 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids:QPNLVYQMASTSDELDPADQNELASTNDSQLGFLPEAEMFSLKTILSPKNMEPSKISGLIV
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified


  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For HIER pH6 retrieval is recommended.
Control Peptide
CAT1 Protein (NBP1-90066PEP)

Alternate Names for CAT1 Antibody

  • amino acid transporter, cationic 1
  • ATRC1
  • CAT-1System Y+ basic amino acid transporter
  • Ecotropic retroviral leukemia receptor homolog
  • ecotropic retroviral receptor
  • Ecotropic retrovirus receptor homolog
  • HCAT1
  • high affinity cationic amino acid transporter 1
  • REC1L
  • SLC7A1
  • solute carrier family 7 (cationic amino acid transporter, y+ system), member 1
  • Solute carrier family 7 member 1


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, ICC/IF, IP, S-ELISA
Species: Hu
Applications: WB
Species: Hu
Applications: WB, ICC/IF, PEP-ELISA
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC
Species: Hu, Mu, Rt, Po, Av, Fe, Fi, Rb, Xp
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Po, Am, Bv, Ca, Dr
Applications: WB, IHC, IHC-Fr, IHC-P
Species: Hu, Mu, Rt, Av, Bv, Pm
Applications: WB, B/N, Flow, GS, ICC/IF, IHC, IHC-Fr, IHC-P, IP
Species: Hu, Rt
Applications: WB, ICC/IF
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, PEP-ELISA, IHC-WhMt
Species: Hu
Applications: WB, Flow, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ELISA
Species: Hu
Applications: WB, IHC, IHC-P

Publications for CAT1 Antibody (NBP1-90066) (0)

There are no publications for CAT1 Antibody (NBP1-90066).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CAT1 Antibody (NBP1-90066) (0)

There are no reviews for CAT1 Antibody (NBP1-90066). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CAT1 Antibody (NBP1-90066). (Showing 1 - 3 of 3 FAQ).

  1. Will these antibodies react with the mouse Slc7a1 receptor for purposes of immunocytochemistry or immunohistochemistry? If yes, do you have any images you can send for examples of its application?
    • NBP1-59857 has been validated for Western blot in human and pig tissue. NBP1-90066 has been validated for use in IHC-Paraffin in human tissue. We cannot guarantee that either of these antibodies will work in mouse IHC or ICC, however if you'd be interested in testing one of these antibodies in mouse IHC or ICC our Innovator's Rewards program may be of interest to you. Through this program if you complete an online review with image, detailing your positive or negative results we will send you a discount voucher for 100% of the purchase price of the reviewed product.
  2. What is the amino acid sequence and species of the immunogen?
    • The immunogen sequence for NBP1-59857 is LGFIMVSGFVKGSVKNWQLTEEDFGNTSGRLCLN of the human protein. The epitope recognized by NBP1-90066 maps to the antigen sequence: QPNLVYQMASTSDELDPADQNELASTNDSQLGFLPEAEMFSLKTILSPKNMEPSKISGLIV of the human protein.
  3. Are you aware of any publications that have used these specific Abs? If yes, could you supply any relevant references?
    • There are currently no product specific references associated with either one of these antibodies.

Secondary Antibodies


Isotype Controls

Additional CAT1 Antibody Products

Related Products by Gene

Bioinformatics Tool for CAT1 Antibody (NBP1-90066)

Discover related pathways, diseases and genes to CAT1 Antibody (NBP1-90066). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CAT1 Antibody (NBP1-90066)

Discover more about diseases related to CAT1 Antibody (NBP1-90066).

Pathways for CAT1 Antibody (NBP1-90066)

View related products by pathway.

PTMs for CAT1 Antibody (NBP1-90066)

Learn more about PTMs related to CAT1 Antibody (NBP1-90066).

Blogs on CAT1

There are no specific blogs for CAT1, but you can read our latest blog posts.

Contact Information

Product PDFs


Gene Symbol SLC7A1

Customer Resources

Novus Review - Submit your review and earn rewards points which can be used for merchandise & discounts.
Risk Free Testing - Test on a species/application not listed above to receive a full credit towards a future purchase.

Novus' Quality Guarantee - Novus guarantees that every product we sell will work in the application and species listed on our website and datasheets.

Submit your question on NBP1-90066 below.
During business hours, we will respond to your email within 24 hours. For any questions submitted on the weekend, a response will be received on Monday.
For immediate assistance during business hours M- F (excluding major holidays), please contact us.
Ask a Scientist - We have a lab full of white coats just waiting for your scientific questions and concerns.

Customers Who Bought This Also Bought