CAT1 Antibody

Images

 
Western Blot: CAT1 Antibody [NBP1-90066] - Analysis in control (vector only transfected HEK293T lysate) and SLC7A1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunohistochemistry-Paraffin: CAT1 Antibody [NBP1-90066] - Staining of human small intestine shows strong membranous positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CAT1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:QPNLVYQMASTSDELDPADQNELASTNDSQLGFLPEAEMFSLKTILSPKNMEPSKISGLIV
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SLC7A1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:10-1:20
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
CAT1 Protein (NBP1-90066PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for CAT1 Antibody

  • amino acid transporter, cationic 1
  • ATRC1
  • ATRC1ERR
  • CAT1
  • CAT-1System Y+ basic amino acid transporter
  • Ecotropic retroviral leukemia receptor homolog
  • ecotropic retroviral receptor
  • Ecotropic retrovirus receptor homolog
  • HCAT1
  • high affinity cationic amino acid transporter 1
  • REC1L
  • REC1LCAT1
  • SLC7A1
  • solute carrier family 7 (cationic amino acid transporter, y+ system), member 1
  • Solute carrier family 7 member 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
H00009815-M03
Species: Hu
Applications: WB, ELISA, ICC/IF, IP
NBP2-58924
Species: Hu
Applications: ICC/IF
NB100-93520
Species: Hu
Applications: WB, ICC/IF, PEP-ELISA
NBP1-32108
Species: Hu, Rt
Applications: WB, ICC/IF
NBP2-45897
Species: Hu
Applications: WB, IHC
NBP1-78911
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-47254
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
PP-H6812-00
Species: Hu
Applications: WB, IHC, IP, DirELISA
NB300-605
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB300-500
Species: Hu, Mu, Rt, Po, Am, Bv, Ca, Dr
Applications: WB, IHC, IHC-Fr, IHC-P
NB100-74413
Species: Hu, Mu, Rb
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-74138
Species: Hu, Rt
Applications: WB, ICC/IF, IHC
NBP2-30868
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-858
Species: Hu, Mu, Rt, GP, Mk
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, PEP-ELISA, IHC-WhMt
NBP2-36491
Species: Hu
Applications: WB, Flow, IHC, IHC-P, Flow-CS
NBP2-47415
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-86613
Species: Hu
Applications: WB, IHC, IHC-P
H00009056-B01P
Species: Hu, Rt
Applications: WB
NBP1-90066
Species: Hu
Applications: WB, IHC, IHC-P

Publications for CAT1 Antibody (NBP1-90066) (0)

There are no publications for CAT1 Antibody (NBP1-90066).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CAT1 Antibody (NBP1-90066) (0)

There are no reviews for CAT1 Antibody (NBP1-90066). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CAT1 Antibody (NBP1-90066). (Showing 1 - 3 of 3 FAQ).

  1. Will these antibodies react with the mouse Slc7a1 receptor for purposes of immunocytochemistry or immunohistochemistry? If yes, do you have any images you can send for examples of its application?
    • NBP1-59857 has been validated for Western blot in human and pig tissue. NBP1-90066 has been validated for use in IHC-Paraffin in human tissue. We cannot guarantee that either of these antibodies will work in mouse IHC or ICC, however if you'd be interested in testing one of these antibodies in mouse IHC or ICC our Innovator's Rewards program may be of interest to you. Through this program if you complete an online review with image, detailing your positive or negative results we will send you a discount voucher for 100% of the purchase price of the reviewed product.
  2. What is the amino acid sequence and species of the immunogen?
    • The immunogen sequence for NBP1-59857 is LGFIMVSGFVKGSVKNWQLTEEDFGNTSGRLCLN of the human protein. The epitope recognized by NBP1-90066 maps to the antigen sequence: QPNLVYQMASTSDELDPADQNELASTNDSQLGFLPEAEMFSLKTILSPKNMEPSKISGLIV of the human protein.
  3. Are you aware of any publications that have used these specific Abs? If yes, could you supply any relevant references?
    • There are currently no product specific references associated with either one of these antibodies.

Secondary Antibodies

 

Isotype Controls

Additional CAT1 Products

Bioinformatics Tool for CAT1 Antibody (NBP1-90066)

Discover related pathways, diseases and genes to CAT1 Antibody (NBP1-90066). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CAT1 Antibody (NBP1-90066)

Discover more about diseases related to CAT1 Antibody (NBP1-90066).
 

Pathways for CAT1 Antibody (NBP1-90066)

View related products by pathway.

PTMs for CAT1 Antibody (NBP1-90066)

Learn more about PTMs related to CAT1 Antibody (NBP1-90066).

Blogs on CAT1

There are no specific blogs for CAT1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CAT1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SLC7A1
Entrez