CAT1 Antibody - BSA Free

Analysis in human cell line SCLC-21H.

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

CAT1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit CAT1 Antibody - BSA Free (NBP1-90066) is a polyclonal antibody validated for use in IHC and WB. Anti-CAT1 Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: QPNLVYQMASTSDELDPADQNELASTNDSQLGFLPEAEMFSLKTILSPKNMEPSKISGLIV
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SLC7A1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin Reported in scientific literature (PMID:29094484)
  • Western Blot 0.04 - 0.4 ug/ml
• Control Peptide:

  CAT1 Protein (NBP1-90066PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for CAT1 Antibody - BSA Free

• amino acid transporter, cationic 1
• ATRC1
• ATRC1ERR
• CAT1
• CAT-1System Y+ basic amino acid transporter
• Ecotropic retroviral leukemia receptor homolog
• ecotropic retroviral receptor
• Ecotropic retrovirus receptor homolog
• HCAT1
• high affinity cationic amino acid transporter 1
• REC1L
• REC1LCAT1
• SLC7A1
• solute carrier family 7 (cationic amino acid transporter, y+ system), member 1
• Solute carrier family 7 member 1

Background

High-affinity, low capacity permease involved in the transport of the cationic amino acids (arginine, lysine and ornithine) in non-hepatic tissues. May also function as an ecotropic retroviral leukemia receptor

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for CAT1 Antibody (NBP1-90066)(1)

Publication using NBP1-90066

• Li YY, Wu C, Shah SS et al. Degradation of AMPK-a1 sensitizes BRAF inhibitor-resistant melanoma cells to arginine deprivation. Mol Oncol 2017-12-01 [PMID: 29094484] (IHC-P)

FAQs for CAT1 Antibody (NBP1-90066). (Showing 1 - 3 of 3 FAQ).

1. Will these antibodies react with the mouse Slc7a1 receptor for purposes of immunocytochemistry or immunohistochemistry? If yes, do you have any images you can send for examples of its application?
   • NBP1-59857 has been validated for Western blot in human and pig tissue. NBP1-90066 has been validated for use in IHC-Paraffin in human tissue. We cannot guarantee that either of these antibodies will work in mouse IHC or ICC, however if you'd be interested in testing one of these antibodies in mouse IHC or ICC our Innovator's Rewards program may be of interest to you. Through this program if you complete an online review with image, detailing your positive or negative results we will send you a discount voucher for 100% of the purchase price of the reviewed product.
2. What is the amino acid sequence and species of the immunogen?
   • The immunogen sequence for NBP1-59857 is LGFIMVSGFVKGSVKNWQLTEEDFGNTSGRLCLN of the human protein. The epitope recognized by NBP1-90066 maps to the antigen sequence: QPNLVYQMASTSDELDPADQNELASTNDSQLGFLPEAEMFSLKTILSPKNMEPSKISGLIV of the human protein.
3. Are you aware of any publications that have used these specific Abs? If yes, could you supply any relevant references?
   • There are currently no product specific references associated with either one of these antibodies.

Bioinformatics

• Gene Symbol: SLC7A1