CARF/CDKN2AIP Antibody - BSA Free

Western Blot: CARF/CDKN2AIP Antibody [NBP1-86628] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp

Immunohistochemistry-Paraffin: CARF/CDKN2AIP Antibody [NBP1-86628] - Staining of human testis shows strong cytoplasmic and nuclear positivity in cells in seminiferus ducts and Leydig cells.

Staining of human cerebral cortex shows moderate nuclear positivity in glial cells.

Staining of human stomach shows moderate nuclear positivity in glandular cells.

Staining of human skin shows moderate nuclear positivity in squamous epithelial cells.

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Human cell line RT-4Lane 3: Human cell line U-251MG sp

Staining of human testis shows strong nuclear and cytoplasmic positivity in cells in seminiferous ducts and leydig.

• Reactivity: Hu, Mu, Rt
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

CARF/CDKN2AIP Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: ELRCKSVYLGTGCGKSKENAKAVASREALKLFLKKKVVVKICKRKYRGSEIEDLVLLDEESRPVNLPPAL
• Predicted Species: Mouse (99%), Rat (99%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CDKN2AIP
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  CARF/CDKN2AIP Protein (NBP1-86628PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for CARF/CDKN2AIP Antibody - BSA Free

• CARF
• CARFCDKN2A-interacting protein
• CDKN2A interacting protein
• CDKN2AIP
• collaborates/cooperates with ARF (alternate reading frame) protein
• Collaborator of ARF
• FLJ20036

Background

Activates TP53/p53 by CDKN2A-dependent and CDKN2A-independent pathways

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CDKN2AIP