Home » Cardiotrophin-1/CT-1 » Cardiotrophin 1 Research Products » Cardiotrophin-1/CT-1 Antibody

Cardiotrophin-1/CT-1 Antibody

 Submit a Review

Images

 
(
Enlarge)
Western Blot: Cardiotrophin-1/CT-1 Antibody [NBP1-79474] - 721_B cell lysate, concentration 0.2-1 ug/ml.
Western Blot: Cardiotrophin-1/CT-1 Antibody [NBP1-79474] - 721_B cell lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity Hu, Mu, Rt, Po, Bv, Ca, Eq, RbSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

Cardiotrophin-1/CT-1 Antibody Summary

Immunogen
Synthetic peptide directed towards the N terminal of human CTF1. Peptide sequence HSLAHLLTKYAEQLLQEYVQLQGDPFGLPSFSPPRLPVAGLSAPAPSHAG.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CTF1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot 1:1000
Application Notes
This is a rabbit polyclonal antibody against CTF1 and was validated on Western blot.
Theoretical MW
21 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Cardiotrophin-1/CT-1 Antibody

  • cardiophin 1
  • cardiotrophin 1
  • Cardiotrophin1
  • Cardiotrophin-1
  • CT-1CT1
  • CTF1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

IL-6 [Unconjugated]
7270-IL/CF
IL-6 [Unconjugated]
Species: Hu
LIF Antibody
(39N7D10)
NBP2-27406
Western Blot: LIF Antibody (39N7D10) [NBP2-27406] - LIF expression in human primary T-cells and cancer cell lines: Jurkat and K562. Image from verified customer review.
Immunohistochemistry-Paraffin: LIF Antibody (39N7D10) [NBP2-27406] - Tissue section of mouse brain using 5 ug/ml concentration of LIF antibody (clone 39N7D10).
Western Blot: LIF Antibody (39N7D10) [NBP2-27406] - WB validation of LIF antibody (clone 39N7D10) on (A) full-length recombinant Lif protein, (B) mouse spleen lysate and (C) human spleen lysate. 3 ug/mL concentration of primary antibody, Goat anti-rat IgG HRP secondary antibody and PicoTect ECL substrate solution were used for this assay.
(1 Review)
Species: Hu, Mu
Applications: WB, IHC, IHC-P
CNTF [Unconjugated]
257-NT
1 μg/lane of Recombinant Human CNTF was resolved with SDS-PAGE under reducing (R) conditions and visualized by silver staining, showing a band at 26 kDa.
Recombinant Human CNTF (Catalog #257‑NT) stimulates cell proliferation of the TF-1 human erythroleukemic cell line. The ED50 for this effect is 0.03-0.18 μg/mL.
(24 Publications)
Species: Hu
Oncostatin M/OSM
[Unconjugated]
8475-OM/CF
Oncostatin M/OSM [Unconjugated]
(1 Publication)
Species: Hu
LRPPRC Antibody
NBP2-38300
Western Blot: LRPPRC Antibody [NBP2-38300] - Analysis in U2OS cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-LRPPRC antibody. Remaining relative intensity is presented.
Immunocytochemistry/Immunofluorescence: LRPPRC Antibody [NBP2-38300] - Staining of human cell line U-2 OS shows localization to mitochondria. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: LRPPRC Antibody [NBP2-38300] - Staining of human liver.
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
LIFR alpha
Antibody [Unconjugate
AF-249-NA
Recombinant Human LIF stimulates proliferation in the TF‑1 human erythroleukemic cell line in a dose-dependent manner (orange line). Proliferation elicited by 0.3 ng/mL Recombinant Human LIF is neutralized (green line) by increasing concentrations of Goat Anti-Human LIF R alpha Antigen Affinity-purified Polyclonal Antibody (Catalog # AF-249-NA). The ND50 is typically 6-36 µg/mL.
(11 Publications)
Species: Hu
Applications: WB, Neut
STAT3 Antibody
(9D8)
NBP2-22471
Western Blot: STAT3 Antibody (9D8) [NBP2-22471] - Human breast cancer cell MDA-MB-231 was treated with carboplatin for 72 hours and the expression of p-Stat3 at Y705 and total Stat3 were detected by western blot. From verified customer review.
Immunocytochemistry/Immunofluorescence: STAT3 Antibody (9D8) [NBP2-22471] - Analysis of STAT3 using anti-STAT3 (9D8) monoclonal antibody (shown in green) in HeLa cells. Formalin fixed cells were permeabilized with 0.1% Triton X-100 in TBS for 10 minutes at room temperature. Cells were then blocked with 1% Blocker BSA for 15 minutes at room temperature. Cells were probed with a mouse monoclonal antibody recognizing STAT3, at a dilution of 1:100 for at least 1 hour at room temperature. Cells were then washed with PBS and incubated with DyLight 488 goat-anti-mouse secondary antibody at a dilution of 1:400 for 30 minutes at room temperature. Nuclei (blue) were stained with Hoechst 33342 dye.
Immunohistochemistry-Paraffin: STAT3 Antibody (9D8) [NBP2-22471] - Biopsies of normal and cancer tissues.
(1 Review)
(2 Publications)
Species: Hu, Mu, Rt, Mk, Pm
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP, KD
IL-11
[Unconjugated]
418-ML
IL-11 [Unconjugated]
(25 Publications)
Species: Mu
CCM2 Antibody
(OTI1E9)
NBP2-01134
Western Blot: CCM2 Antibody (1E9) [NBP2-01134] Analysis of extracts (35ug) from 9 different cell lines by using anti-CCM2 monoclonal antibody.
Immunohistochemistry-Paraffin: CCM2 Antibody (1E9) [NBP2-01134] - Staining of paraffin-embedded Human lymph node tissue using anti-CCM2 mouse monoclonal antibody.
Western Blot: CCM2 Antibody (1E9) [NBP2-01134] - HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY CCM2 (Right lane) cDNA for 48 hrs and lysed. Equivalent amounts of cell lysates (5 ug per lane) were separated by SDS-PAGE and immunoblotted with anti-CCM2.
Species: Hu
Applications: WB, IHC, IHC-P
NOD2 Antibody (2D9)
NB100-524
Western Blot: NOD2 Antibody (2D9) [NB100-524] - Total protein from human THP1 and US-OS cells and mouse Raw264.7 cells was separated on a 7.5% gel by SDS-PAGE, transferred to PVDF membrane and blocked in 5% non-fat milk in TBST. The membrane was probed with 2.0 ug/ml anti-NOD2 in 1% non-fat milk in TBST and detected with an anti-mouse HRP secondary antibody using chemiluminescence.
Immunocytochemistry/Immunofluorescence: NOD2 Antibody (2D9) [NB100-524] - A431 cells were fixed for 10 minutes using 10% formalin and then permeabilized for 5 minutes using 1X TBS + 0.5% Triton X-100. The cells were incubated with anti-NOD2 (2D9) NB100-524 at a 1:200 dilution overnight at 4C and detected with an anti-mouse DyLight 488 (Green) at a 1:500 dilution. Actin was counterstained with Phalloidin 568 (Red) at a 1:200 dilution. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.
Immunohistochemistry-Frozen: NOD2 Antibody (2D9) [NB100-524] - Overlay of NOD2-DyLight 488 (green) with phase contrast of murine colon. Image from verified customer review.
(1 Review)
(16 Publications)
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
HLA DQ Antibody
(SPV-L3)
NBP2-45041
Flow Cytometry: HLA DQ Antibody (SPV-L3) [NBP2-45041] - Flow Cytometric Analysis of Raji cells. HLA DQ Antibody (SPV-L3) followed by goat anti-Mouse IgG-CF488 (Blue); Isotype Control (Red).
(1 Publication)
Species: Hu, Po
Applications: Flow, IHC, IHC-Fr, IF
CTLA-4
[Unconjugated]
7268-CT
Recombinant Human CTLA-4 Fc Chimera (Catalog # 7268-CT) inhibits IL-2 secretion by stimulated Jurkat human acute Tcell leukemia cells. The ED50 for this effect is 0.03-0.15 μg/mL whenstimulated with 1 μg/mL Recombinant Human B7‑1/CD80 Fc Chimera (Catalog # 140-B1).
(1 Publication)
Species: Hu
ERK1 Antibody (1E5)
NBP2-22203
Western Blot: ERK1 Antibody (1E5) [NBP2-22203] - Western blot analysis of whole cell lysates from (1) MCF7 (2) NIH3T3 cell lines using ERK1 antibody (clone 1E5) at 1:1000 dilution. The signal was developed using HRP labeled goat-anti Mouse secondary antibody with ECL based detection.
Immunocytochemistry/Immunofluorescence: ERK1 Antibody (1E5) [NBP2-22203] - Analysis of NIH/3T3 cells using ERK1 mouse mAb (green). Blue: DRAQ5 fluorescent DNA dye. Red: Actin filaments have been labeled with Alexa Fluor-555 phalloidin.
Immunohistochemistry-Paraffin: ERK1 Antibody (1E5) [NBP2-22203] - Immunohistochemical analysis of paraffin-embedded breast cancer tissues using ERK1 mouse mAb with DAB staining.
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
ERK2 Antibody
(SZ25-01)
NBP2-67360
Western Blot: ERK2 Antibody (SZ25-01) [NBP2-67360] - Analysis of ERK2 on different lysates using anti-ERK2 antibody at 1/1,000 dilution. Positive control: Lane 1: Hela Lane 2: PC-12
Immunocytochemistry/Immunofluorescence: ERK2 Antibody (SZ25-01) [NBP2-67360] - Staining ERK2 in NIH/3T3 cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Immunohistochemistry-Paraffin: ERK2 Antibody (SZ25-01) [NBP2-67360] - Analysis of paraffin-embedded mouse stomach tissue using anti-ERK2 antibody. Counter stained with hematoxylin.
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
ACAT Antibody
NB400-141
ACAT Antibody
(4 Publications)
Species: Hu, Mu, Ha
Applications: WB, ICC/IF, IP
SLC22A16 Antibody
NB100-55400
Immunohistochemistry-Paraffin: SLC22A16 Antibody [NB100-55400] - (4ug/ml) staining of paraffin embedded Human Testis. Microwaved antigen retrieval with Tris/EDTA buffer pH9, HRP-staining.
(1 Publication)
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA
CTAG2 Antibody
NBP2-49659
Immunohistochemistry-Paraffin: CTAG2 Antibody [NBP2-49659] - Staining of human prostate shows low expression as expected.
Immunohistochemistry-Paraffin: CTAG2 Antibody [NBP2-49659] - Staining of human testis shows high expression.
Immunohistochemistry-Paraffin: CTAG2 Antibody [NBP2-49659] - Staining in human testis and prostate tissues using anti-CTAG2 antibody. Corresponding CTAG2 RNA-seq data are presented for the same tissues.
Species: Hu
Applications: IHC, IHC-P
AKT [p Ser473]
Antibody - Pan Specif
AF887
Western blot shows lysates of NIH‑3T3 mouse embryonic fibroblast cell line untreated (-) or treated (+) with 100 ng/mL Human PDGF (Catalog # 120‑HD) for 15 minutes and MCF‑7 human breast cancer cell line untreated or treated with 100 ng/mL Recombinant Human IGF-1 (Catalog # 291‑G1) for 15 minutes. PVDF membrane was probed with 0.5 µg/mL of Rabbit Anti-Human/Mouse/Rat Phospho-Akt (S473) Pan Specific Antigen Affinity-purified Polyclonal Antibody (Catalog # AF887), followed by HRP-conjugated Anti-Rabbit IgG Secondary Antibody (Catalog # HAF008). A specific band was detected for Phospho-Akt (S473) Pan Specific at approximately 60 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Akt phosphorylated at S473 was detected in immersion fixed paraffin-embedded sections of human breast cancer tissue using Rabbit Anti-Human/Mouse/Rat Phospho-Akt (S473) Antigen Affinity-purified Polyclonal Antibody (Catalog # AF887) at 10 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Rabbit HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS005) and counterstained with hematoxylin (blue). Lower panel shows a lack of labeling if primary antibodies are omitted and tissue is stained only with secondary antibody followed by incubation with detection reagents. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
Simple Western lane view shows lysates of MCF‑7 human breast cancer cell line and A549 human lung carcinoma cell line untreated (-) or treated (+) with 100 ng/mL Recombinant Human IGF‑I (Catalog # 291-G1) for 15 minutes, loaded at 0.2 mg/mL. A specific band was detected for Phospho-Akt (S473) at approximately 60 kDa (as indicated) using 5 µg/mL of Rabbit Anti-Human/Mouse/Rat Phospho-Akt (S473) Pan Specific Antigen Affinity-purified Polyclonal Antibody (Catalog # AF887). This experiment was conducted under reducing conditions and using the 12-230 kDa separation system.
(22 Publications)
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow

Publications for Cardiotrophin-1/CT-1 Antibody (NBP1-79474) (0)

There are no publications for Cardiotrophin-1/CT-1 Antibody (NBP1-79474).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Cardiotrophin-1/CT-1 Antibody (NBP1-79474) (0)

There are no reviews for Cardiotrophin-1/CT-1 Antibody (NBP1-79474). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Cardiotrophin-1/CT-1 Antibody (NBP1-79474) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Learn about Custom Antibody Labeling

Additional Cardiotrophin-1/CT-1 Products

Bioinformatics Tool for Cardiotrophin-1/CT-1 Antibody (NBP1-79474)

Discover related pathways, diseases and genes to Cardiotrophin-1/CT-1 Antibody (NBP1-79474). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Cardiotrophin-1/CT-1 Antibody (NBP1-79474)

Discover more about diseases related to Cardiotrophin-1/CT-1 Antibody (NBP1-79474).
 

Pathways for Cardiotrophin-1/CT-1 Antibody (NBP1-79474)

View related products by pathway.

PTMs for Cardiotrophin-1/CT-1 Antibody (NBP1-79474)

Learn more about PTMs related to Cardiotrophin-1/CT-1 Antibody (NBP1-79474).
 

Research Areas for Cardiotrophin-1/CT-1 Antibody (NBP1-79474)

Find related products by research area.

Blogs on Cardiotrophin-1/CT-1

There are no specific blogs for Cardiotrophin-1/CT-1, but you can read our latest blog posts.
Recombinant Monoclonal Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Cardiotrophin-1/CT-1 Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol CTF1
Uniprot