CARD8 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: CARD8 Antibody [NBP2-47527] - Staining of human cell line U-2 OS shows localization to nucleoplasm & cytosol. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: CARD8 Antibody [NBP2-47527] - Staining of human placenta tissue. Shows strong cytoplasmic and nuclear positivity in trophoblastic cells.

• Reactivity: Hu
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

CARD8 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: TLVWDTEVKPVDLQLVAASAPPPFSGAAFVKENHRQLQARMGDLKGVLDDLQDNEVLTENEKELVEQEKTRQSKNEALLSMVEKKGDLA
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CARD8
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  CARD8 Protein (NBP2-47527PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for CARD8 Antibody - BSA Free

• Apoptotic protein NDPP1
• CARD inhibitor of NF-kappaB-activating ligands
• CARDINALFLJ18121
• CARD-inhibitor of NF-kappa-B-activating ligand
• caspase recruitment domain family, member 8
• caspase recruitment domain-containing protein 8
• DACAR
• DAKAR
• KIAA0955DKFZp779L0366
• NDPP
• NDPP1MGC57162
• TUCANFLJ18119
• Tumor up-regulated CARD-containing antagonist of CASP9
• tumor up-regulated CARD-containing antagonist of caspase nine

Background

TUCAN (also known as CARD8 and CARDINAL) is a CARD domain containing protein. TUCAN stands for tumor-up-regulated CARD-containing antagonist of caspase nine. Proteins containing a CARD (caspase-associated recruitment domain) domain are key regulators of cell death, cell survival and cytokine production (reviewed in Damiano and Reed, 2004). CARD domains are found in the N-terminal pro-domains of certain caspases, a family of apoptotic and pro-inflammatory proteases, as well as in a diversity of other proteins including TUCAN. CARD domains are homotypic protein interaction motifs that enable networks of proteins to communicate via CARD-CARD interactions. TUCAN is an anti-apoptotic CARD protein that can protect tumors from cell death stimuli, and is overexpressed in certain forms of cancer. The role of TUCAN in tumor biology remains to be fully elucidated, and there appears to be be various mechanisms by TUCAN can potentially contribute to apoptosis resistance (reviewed in Checinska et al, 2006). For example, TUCAN has been shown to inhibit caspase-9 activation by binding to the CARD region of pro-caspase-9, thereby suppressing the formation of the Apaf-1-caspase-9 apoptotic complex and apoptosis. Additionally, a TUCAN isoform has been described that blocks both caspase-8 and caspase-9 mediated apoptosis. However, in some tumors, TUCAN does not appear to interact with caspase-9 and may play a role in modulating NF-kB transcription factor survivial signaling pathways. In this regard a CARD-independent interaction of TUCAN with Ikkg has been described, resulting in the inhibition of interleukin-1 and TNF-induced NF-kB activation. Human TUCAN is a 431 amino acid protein according to GenBank no. gi|14424229|sp|Q9Y2G2|CARD8_HUMAN, and migrates at ~45-49 kDa on SDS-PAGE.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CARD8