Carbonic Anhydrase VI Antibody

Images

 
Western Blot: Carbonic Anhydrase VI Antibody [NBP1-87537] - Analysis in control (vector only transfected HEK293T lysate) and CA6 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian ...read more
Immunohistochemistry-Paraffin: Carbonic Anhydrase VI Antibody [NBP1-87537] - Staining of human lymph node.
Immunohistochemistry-Paraffin: Carbonic Anhydrase VI Antibody [NBP1-87537] - Staining of human salivary gland shows strong cytoplasmic and extra cellular positivity in glandular cells.
Immunohistochemistry-Paraffin: Carbonic Anhydrase VI Antibody [NBP1-87537] - Staining of human colon shows low expression as expected.
Orthogonal Strategies: Immunohistochemistry-Paraffin: Carbonic Anhydrase VI Antibody [NBP1-87537] - Staining in human salivary gland and colon tissues using anti-CA6 antibody. Corresponding CA6 RNA-seq data are ...read more
Independent Antibodies: Immunohistochemistry-Paraffin: Carbonic Anhydrase VI Antibody [NBP1-87537] - Staining of human colon, liver, lymph node and salivary gland using Anti-CA6 antibody NBP1-87537 (A) shows ...read more
Immunohistochemistry-Paraffin: Carbonic Anhydrase VI Antibody [NBP1-87537] - Staining of human liver.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Carbonic Anhydrase VI Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: PPCTENVHWFVLADFVKLSRTQVWKLENSLLDHRNKTIHNDYRRTQPLNHRVVESNFPNQEYTLGSEFQFYL
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CA6
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Carbonic Anhydrase VI Protein (NBP1-87537PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Carbonic Anhydrase VI Antibody

  • CA6
  • Carbonate dehydratase VI
  • carbonic anhydrase 6
  • Carbonic Anhydrase VI
  • carbonic anhydrase VIGUSTIN
  • CA-VI
  • EC 4.2.1.1
  • Gustin
  • MGC21256
  • Salivary carbonic anhydrase
  • Secreted carbonic anhydrase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB600-919
Species: Hu, Mu
Applications: ELISA, IHC, IHC-Fr, IHC-P, WB
MAB2186
Species: Hu
Applications: IHC, IP, WB
NB600-1335
Species: Hu, Mu, Pm, Rt
Applications: ChIP, ELISA, Flow, GS, ICC/IF, IHC, IHC-P, IP, KD, Simple Western, WB
NBP1-88191
Species: Hu, Mu
Applications: IHC, IHC-P, WB
NB100-1533
Species: Hu, Mu, Po, Rt, Sh
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA, WB
NBP2-37493
Species: Hu, Mu, Po
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, WB
MAB1936
Species: Hu
Applications: IP, WB
AF4274
Species: Mu
Applications: IHC, WB
NBP1-81838
Species: Hu, Mu
Applications: IHC, IHC-P, WB
3177-CA
Species: Hu
Applications: EnzAct
NBP2-33404
Species: Hu
Applications: IHC, IHC-P
2914-HT
Species: Hu
Applications: BA
NBP1-83396
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-06274
Species: Ce, Ch, Dr, Hu, Mu, Rt, Sh, Ze
Applications: Flow, ICC/IF, IHC-FrFl, IHC, IHC-P, Simple Western, WB
NBP1-62322
Species: Hu
Applications: WB
AF3865
Species: Hu
Applications: IHC, WB
MAB25031
Species: Hu
Applications: IHC, IP, WB
NBP1-87537
Species: Hu
Applications: WB, IHC, IHC-P

Publications for Carbonic Anhydrase VI Antibody (NBP1-87537) (0)

There are no publications for Carbonic Anhydrase VI Antibody (NBP1-87537).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Carbonic Anhydrase VI Antibody (NBP1-87537) (0)

There are no reviews for Carbonic Anhydrase VI Antibody (NBP1-87537). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Carbonic Anhydrase VI Antibody (NBP1-87537) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Carbonic Anhydrase VI Products

Bioinformatics Tool for Carbonic Anhydrase VI Antibody (NBP1-87537)

Discover related pathways, diseases and genes to Carbonic Anhydrase VI Antibody (NBP1-87537). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Carbonic Anhydrase VI Antibody (NBP1-87537)

Discover more about diseases related to Carbonic Anhydrase VI Antibody (NBP1-87537).
 

Pathways for Carbonic Anhydrase VI Antibody (NBP1-87537)

View related products by pathway.

PTMs for Carbonic Anhydrase VI Antibody (NBP1-87537)

Learn more about PTMs related to Carbonic Anhydrase VI Antibody (NBP1-87537).
 

Research Areas for Carbonic Anhydrase VI Antibody (NBP1-87537)

Find related products by research area.

Blogs on Carbonic Anhydrase VI.

CHOP/GADD153 - A regulator and marker for ER-stress induced apoptosis
C/EBP homologous protein (CHOP) is a transcription factor that regulates apoptosis in response to cellular stress. CHOP also known as growth arrest and DNA damage 153 (GADD153) was first cloned because of its induction in response to genotoxic str...  Read full blog post.

Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Carbonic Anhydrase VI Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CA6