Carbonic Anhydrase X/CA10 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: Carbonic Anhydrase X/CA10 Antibody [NBP2-55638] - Staining of human cell line RT4 shows localization to vesicles.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Carbonic Anhydrase X/CA10 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: PSQIFLSMSDNFRPVQPLNNRCIRTNINFSLQGKDCPNNRAQKLQYRVNEWLLK
Specificity
Specificity of human Carbonic Anhydrase X/CA10 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CA10
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Carbonic Anhydrase X/CA10 Recombinant Protein Antigen (NBP2-55638PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for Carbonic Anhydrase X/CA10 Antibody

  • CA10
  • Carbonic Anhydrase X
  • carbonic anhydrase-related protein 10
  • Carbonic anhydrase-related protein X
  • CARP X
  • CARPX
  • CA-RPX
  • CARPXCA-RP X
  • Cerebral protein 15
  • cerebral protein-15
  • HUCEP-15

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBL1-08611
Species: Hu
NB100-56082
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, IP
NBP1-81776
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-88871
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-2593
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
NB120-19347
Species: Hu, Mu, Rt, Po, Bv
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
AF2187
Species: Hu, Mu
Applications: WB, Simple Western, IP
H00056287-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, S-ELISA
NBP2-38530
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00006690-M01
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, IP, S-ELISA
NBP1-47935
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
PP-N4111-00
Species: Hu
Applications: WB, IHC, IP
NBP2-01860
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC
NBP1-37003
Species: Hu
Applications: ICC/IF, IHC, IHC-P, PEP-ELISA
NBP1-88192
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-55638
Species: Hu, Mu, Rt
Applications: ICC/IF

Publications for Carbonic Anhydrase X/CA10 Antibody (NBP2-55638) (0)

There are no publications for Carbonic Anhydrase X/CA10 Antibody (NBP2-55638).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Carbonic Anhydrase X/CA10 Antibody (NBP2-55638) (0)

There are no reviews for Carbonic Anhydrase X/CA10 Antibody (NBP2-55638). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for Carbonic Anhydrase X/CA10 Antibody (NBP2-55638) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional Carbonic Anhydrase X/CA10 Products

Bioinformatics Tool for Carbonic Anhydrase X/CA10 Antibody (NBP2-55638)

Discover related pathways, diseases and genes to Carbonic Anhydrase X/CA10 Antibody (NBP2-55638). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Carbonic Anhydrase X/CA10 Antibody (NBP2-55638)

Discover more about diseases related to Carbonic Anhydrase X/CA10 Antibody (NBP2-55638).
 

Pathways for Carbonic Anhydrase X/CA10 Antibody (NBP2-55638)

View related products by pathway.

PTMs for Carbonic Anhydrase X/CA10 Antibody (NBP2-55638)

Learn more about PTMs related to Carbonic Anhydrase X/CA10 Antibody (NBP2-55638).

Blogs on Carbonic Anhydrase X/CA10

There are no specific blogs for Carbonic Anhydrase X/CA10, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Carbonic Anhydrase X/CA10 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CA10