Carbonic Anhydrase VIII/CA8 Antibody

Images

 
Western Blot: Carbonic Anhydrase VIII/CA8 Antibody [NBP1-86654] - Analysis in human cell line K562.
Immunohistochemistry-Paraffin: Carbonic Anhydrase VIII/CA8 Antibody [NBP1-86654] - Immunohistochemical staining of human cerebellum shows strong cytoplasmic positivity in purkinje cells.
Western Blot: Carbonic Anhydrase VIII/CA8 Antibody [NBP1-86654] - Analysis in mouse cerebellum tissue.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Carbonic Anhydrase VIII/CA8 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:IQYKGKSKTIPCFNPNTLLPDPLLRDYWVYEGSLTIPPCSEGVTWILFRYPLTISQLQIEEFRRLRTHVKGAELVEGCDGILGDNFRPTQP
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Rat (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CA8
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Positive Control
Brain Cerebellum Lysate (NB820-59365)
Control Peptide
Carbonic Anhydrase VIII/CA8 Protein (NBP1-86654PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Carbonic Anhydrase VIII/CA8 Antibody

  • CA8
  • CALS
  • CALScarbonate dehydratase
  • CAMRQ3
  • Carbonic Anhydrase VIII
  • carbonic anhydrase VIIIMGC99509
  • carbonic anhydrase-like sequence
  • carbonic anhydrase-related protein
  • CARP
  • CARPCA-related protein
  • CA-VIII
  • MGC120502

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NB100-1533
Species: Hu, Mu, Po, Sh
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
AF1067
Species: Hu, Mu, Rt
Applications: WB, IHC, Neut
AF1067
Species: Hu, Mu, Rt
Applications: WB, IHC, Neut
NBP2-15397
Species: Hu, Mu
Applications: WB, ICC/IF
NBP2-14510
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB120-11427
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-22449
Species: Hu, Mu, Rt, Fe, GP, Rb
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, GS
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
AF682
Species: Hu
Applications: WB, IHC, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
NBP1-32108
Species: Hu, Rt
Applications: WB, ICC/IF
NBP2-45897
Species: Hu
Applications: WB, IHC
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA
NBP2-61118
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-86654
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for Carbonic Anhydrase VIII/CA8 Antibody (NBP1-86654) (0)

There are no publications for Carbonic Anhydrase VIII/CA8 Antibody (NBP1-86654).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Carbonic Anhydrase VIII/CA8 Antibody (NBP1-86654) (0)

There are no reviews for Carbonic Anhydrase VIII/CA8 Antibody (NBP1-86654). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Carbonic Anhydrase VIII/CA8 Antibody (NBP1-86654) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Positive Control Lysate(s)

Secondary Antibodies

 

Isotype Controls

Additional Carbonic Anhydrase VIII/CA8 Products

Bioinformatics Tool for Carbonic Anhydrase VIII/CA8 Antibody (NBP1-86654)

Discover related pathways, diseases and genes to Carbonic Anhydrase VIII/CA8 Antibody (NBP1-86654). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Carbonic Anhydrase VIII/CA8 Antibody (NBP1-86654)

Discover more about diseases related to Carbonic Anhydrase VIII/CA8 Antibody (NBP1-86654).
 

Pathways for Carbonic Anhydrase VIII/CA8 Antibody (NBP1-86654)

View related products by pathway.

Research Areas for Carbonic Anhydrase VIII/CA8 Antibody (NBP1-86654)

Find related products by research area.

Blogs on Carbonic Anhydrase VIII/CA8

There are no specific blogs for Carbonic Anhydrase VIII/CA8, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Carbonic Anhydrase VIII/CA8 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CA8
Entrez