FRY Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: FRY Antibody [NBP2-14510] - Staining of human cell line U-2 OS shows positivity in nucleoli and cytoplasm.
Immunohistochemistry-Paraffin: FRY Antibody [NBP2-14510] - Staining of human stomach, upper shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

FRY Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: EDVLFGFTNFLLREVNDMHHTLLDSSLKLLLQLLTQWKLVIQTQGKVYEQ ANKIRNSELIANGSSHRIQSERGPHCSVLHAVE
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (95%), Rat (92%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
FRY
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
FRY Protein (NBP2-14510PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for FRY Antibody

  • 13CDNA73
  • 214K23.2
  • bA207N4.2
  • bA37E23.1
  • C13orf14
  • CG003
  • FRY furry homolog (Drosophila)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-88543
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-86654
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-15397
Species: Hu, Mu
Applications: WB, ICC/IF
NB100-1596
Species: Hu, Pm, Rb
Applications: WB, ICC/IF, IHC
AF1067
Species: Hu, Mu, Rt
Applications: WB, IHC, Neut
NB100-128
Species: Hu, Mu, Rt
Applications: ChIP, GS, ICC/IF, IHC, IHC-P
NB100-68241
Species: Hu
Applications: WB, IHC, IHC-P, IP
AF1067
Species: Hu, Mu, Rt
Applications: WB, IHC, Neut
MAB4077
Species: Hu
Applications: WB, IHC
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP1-89522
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
H00728695-B01P
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP1-43435
Species: Hu, Mu
Applications: WB, Flow
NBP2-14510
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P

Publications for FRY Antibody (NBP2-14510) (0)

There are no publications for FRY Antibody (NBP2-14510).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FRY Antibody (NBP2-14510) (0)

There are no reviews for FRY Antibody (NBP2-14510). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for FRY Antibody (NBP2-14510) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional FRY Products

FRY NBP2-14510

Bioinformatics Tool for FRY Antibody (NBP2-14510)

Discover related pathways, diseases and genes to FRY Antibody (NBP2-14510). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FRY Antibody (NBP2-14510)

Discover more about diseases related to FRY Antibody (NBP2-14510).
 

Pathways for FRY Antibody (NBP2-14510)

View related products by pathway.

PTMs for FRY Antibody (NBP2-14510)

Learn more about PTMs related to FRY Antibody (NBP2-14510).

Blogs on FRY

There are no specific blogs for FRY, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our FRY Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol FRY