FRY Antibody

Images

 
Immunohistochemistry-Paraffin: FRY Antibody [NBP2-14510] - Staining of human endometrium shows moderate cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: FRY Antibody [NBP2-14510] - Staining of human stomach, upper shows strong cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: FRY Antibody [NBP2-14510] - Staining of human endometrium shows moderate cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: FRY Antibody [NBP2-14510] - Staining of human gastrointestinal shows moderate cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: FRY Antibody [NBP2-14510] - Staining of human heart muscle shows moderate cytoplasmic positivity in myocytes.
Immunohistochemistry-Paraffin: FRY Antibody [NBP2-14510] - Staining of human kidney shows moderate cytoplasmic positivity in cells in tubules.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

FRY Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the amino acids: EDVLFGFTNFLLREVNDMHHTLLDSSLKLLLQLLTQWKLVIQTQGKVYEQANKIRNSELIANGSSHRIQSERGPHCSVLHAVE
Predicted Species
Mouse (95%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
FRY
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
FRY Protein (NBP2-14510PEP)

Reactivity Notes

Rat (87%).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for FRY Antibody

  • 13CDNA73
  • 214K23.2
  • bA207N4.2
  • bA37E23.1
  • C13orf14
  • CG003
  • FRY furry homolog (Drosophila)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-88543
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
AF2187
Species: Hu, Mu
Applications: IP, Simple Western, WB
NBP2-15397
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
NB100-1596
Species: Hu, Mu, Pm, Rb, Rt
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
AF1067
Species: Hu, Mu, Rt
Applications: ELISA, IHC, Neut, WB
664-LI
Species: Hu
Applications: BA
NB100-128
Species: Hu, Mu, Rt
Applications: ChIP, GS, ICC/IF, IHC, IHC-P, WB
NBP2-47572
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF1067
Species: Hu, Mu, Rt
Applications: ELISA, IHC, Neut, WB
MAB4077
Species: Hu
Applications: IHC, WB
AF3398
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
291-G1
Species: Hu
Applications: BA
NBP1-89522
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-90927
Species: Hu
Applications: IHC, IHC-P, WB
NB100-524
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NBP2-79843
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, WB
7268-CT
Species: Hu
Applications: BA
H00728695-B01P
Species: Hu
Applications: ICC/IF, IP, WB
NBP1-43435
Species: Hu, Mu
Applications: Flow, WB
NBP2-14510
Species: Hu, Mu
Applications: IHC

Publications for FRY Antibody (NBP2-14510) (0)

There are no publications for FRY Antibody (NBP2-14510).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FRY Antibody (NBP2-14510) (0)

There are no reviews for FRY Antibody (NBP2-14510). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for FRY Antibody (NBP2-14510) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our FRY Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol FRY