Carbonic Anhydrase VII/CA7 Antibody

Images

 
Immunohistochemistry-Paraffin: Carbonic Anhydrase VII/CA7 Antibody [NBP2-30702] - Staining of human colon shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Carbonic Anhydrase VII/CA7 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: PINIISSQAVYSPSLQPLELSYEACMSLSITNNGHSVQVDFNDSDDRTVV
Predicted Species
Mouse (98%), Rat (98%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CA7
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Carbonic Anhydrase VII/CA7 Protein (NBP2-30702PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Carbonic Anhydrase VII/CA7 Antibody

  • CA7
  • Carbonate dehydratase VII
  • carbonic anhydrase 7
  • Carbonic Anhydrase VII
  • carbonic anhydrase VIICAVII
  • carbonic dehydratase VII
  • CA-VII
  • EC 4.2.1.1

Background

CA7, also known as Carbonic Anhydrase 7, consists of a 29 kDa and a shorter 23 kDa isoform, is involved in zinc ion binding as a member of the zinc metalloenzyme family that transports HCO3- and a proton (H+) into H20 and CO2. This process occurs in several pathways such as the metabolism and reversible hydration of carbon dioxide pathways. Disease research is currently being studied with relation to CA7 and colorectal cancer, glaucoma, insulin resistance and neuronitis.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Carbonic Anhydrase VII/CA7 Antibody (NBP2-30702) (0)

There are no publications for Carbonic Anhydrase VII/CA7 Antibody (NBP2-30702).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Carbonic Anhydrase VII/CA7 Antibody (NBP2-30702) (0)

There are no reviews for Carbonic Anhydrase VII/CA7 Antibody (NBP2-30702). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Carbonic Anhydrase VII/CA7 Antibody (NBP2-30702) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Carbonic Anhydrase VII/CA7 Products

Research Areas for Carbonic Anhydrase VII/CA7 Antibody (NBP2-30702)

Find related products by research area.

Blogs on Carbonic Anhydrase VII/CA7

There are no specific blogs for Carbonic Anhydrase VII/CA7, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Carbonic Anhydrase VII/CA7 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CA7
Uniprot