CHST8 Antibody

Images

 
Immunohistochemistry-Paraffin: CHST8 Antibody [NBP1-83396] - Staining of human prostate shows membranous and cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CHST8 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:QVPGIKFNIRPRQPHHDLPPGGSQDGDLKEPTERVTRDLSSGAPRGRNLPAPDQPQPPLQRGTRLRLRQRRRRLLIKKMPAAATIPANSSDAPFIRPGPGTLDGRWVSLHRSQQE
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CHST8
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
CHST8 Protein (NBP1-83396PEP)
Publications
Read Publications using
NBP1-83396 in the following applications:

Reactivity Notes

Human reactivity reported in scientific literature (PMID: 22289416).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for CHST8 Antibody

  • carbohydrate (N-acetylgalactosamine 4-0) sulfotransferase 8
  • carbohydrate sulfotransferase 8
  • EC 2.8.2.-
  • GalNAc-4-O-sulfotransferase 1
  • GalNAc4ST
  • GALNAC4ST1
  • GALNAC-4-ST1
  • galNAc4ST-1
  • N-acetylgalactosamine-4-O-sulfotransferase 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-15898
Species: Hu, Mu
Applications: WB
NBP1-81727
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB100-56605
Species: Av, Bv, Sh
Applications: WB
NBP2-30481
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-1533
Species: Hu, Mu, Po, Sh
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
AF2939
Species: Hu
Applications: WB, Simple Western, IP
NBP1-91784
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF5394
Species: Hu, Mu
Applications: WB
MAB840
Species: Hu
Applications: Flow, IHC, CyTOF-ready, ICC, Neut
AF523
Species: Hu
Applications: WB, Simple Western, Flow, CyTOF-ready, Neut
NB600-201
Species: Hu, Mu, Rt, Po, Bv, Ca, Fi, Rb, Sh
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, RIA
NBP2-24713
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, Flow, IHC-P
NB110-60935
Species: Hu, Mu, Pm
Applications: WB
NBP1-76997
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF
NBP2-38770
Species: Hu, Mu
Applications: WB, IHC, IHC-P
H00079092-T01
Species: Hu
H00007001-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP1-91642
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for CHST8 Antibody (NBP1-83396)(2)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 2 applications: ICC/IF, WB.


Filter By Application
ICC/IF
(1)
WB
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for CHST8 Antibody (NBP1-83396) (0)

There are no reviews for CHST8 Antibody (NBP1-83396). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for CHST8 Antibody (NBP1-83396) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CHST8 Products

Bioinformatics Tool for CHST8 Antibody (NBP1-83396)

Discover related pathways, diseases and genes to CHST8 Antibody (NBP1-83396). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CHST8 Antibody (NBP1-83396)

Discover more about diseases related to CHST8 Antibody (NBP1-83396).
 

Pathways for CHST8 Antibody (NBP1-83396)

View related products by pathway.

PTMs for CHST8 Antibody (NBP1-83396)

Learn more about PTMs related to CHST8 Antibody (NBP1-83396).

Blogs on CHST8

There are no specific blogs for CHST8, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CHST8 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CHST8