Carbonic Anhydrase IV/CA4 Antibody (4G6)

Images

 
Western Blot: Carbonic Anhydrase IV/CA4 Antibody (4G6) [H00000762-M08] - Analysis of CA4 expression in A-431.
Sandwich ELISA: Carbonic Anhydrase IV/CA4 Antibody (4G6) [H00000762-M08] - Detection limit for recombinant GST tagged CA4 is 3 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
4G6
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Carbonic Anhydrase IV/CA4 Antibody (4G6) Summary

Immunogen
CA4 (NP_000708.1, 27 a.a. - 126 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. VQAESSNYPCLVPVKWGGNCQKDRQSPINIVTTKAKVDKKLGRFFFSGYDKKQTWTVQNNGHSVMMLLENKASISGGGLPAPYQAKQLHLHWSDLPYKGS
Specificity
CA4 - carbonic anhydrase IV (4G6)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
CA4
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
It has been used for ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Carbonic Anhydrase IV/CA4 Antibody (4G6)

  • CA4
  • CAIV
  • CA-IV
  • Car4
  • Carbonate dehydratase IV
  • carbonic anhydrase 4
  • Carbonic Anhydrase IV
  • carbonic anhydrase IVRP17
  • carbonic dehydratase IV
  • EC 4.2.1.1
  • retinitis pigmentosa 17 (autosomal dominant)
  • RP17

Background

Carbonic anhydrases (CAs) are a large family of zinc metalloenzymes that catalyze the reversible hydration of carbon dioxide. They participate in a variety of biological processes, including respiration, calcification, acid-base balance, bone resorption, and the formation of aqueous humor, cerebrospinal fluid, saliva, and gastric acid. They show extensive diversity in tissue distribution and in their subcellular localization. This gene encodes a glycosylphosphatidyl-inositol-anchored membrane isozyme expressed on the luminal surfaces of pulmonary (and certain other) capillaries and proximal renal tubules. Its exact function is not known; however, it may have a role in inherited renal abnormalities of bicarbonate transport. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF2180
Species: Hu
Applications: WB, Simple Western, IP
AF2185
Species: Hu, Mu, Rt
Applications: WB, IP
NB600-919
Species: Hu, Mu
Applications: WB, ELISA, IHC, IHC-Fr, IHC-P
NB300-141
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, Fe, GP, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-13075
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP, IHC-FrFl
248-BD/CF
Species: Hu, Mu, Rt, Ca, Eq
NBP2-32020
Species: Hu
Applications: IHC, IHC-P
NBP1-89330
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-59744
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr
NBP1-62539
Species: Hu
Applications: WB
NBP2-22449
Species: Hu, Mu, Rt, Fe, GP, Rb
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, GS
NBP2-50037
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF
NBP2-25162
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NB110-41404
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC
NB100-417
Species: Hu, Mu, Rt, Ca, Pl
Applications: WB, Simple Western, ChIP, ELISA, Flow, GS, ICC/IF, IHC, IHC-Fr, IHC-P
NB300-731
Species: Hu, Mu, Rt, GP, Rb, Sh, Ye
Applications: WB, ChIP, B/N, Flow, GS, ICC/IF, IHC, IHC-P, IP
NBP2-21590
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
H00000762-M08
Species: Hu
Applications: WB, ELISA

Publications for Carbonic Anhydrase IV/CA4 Antibody (H00000762-M08) (0)

There are no publications for Carbonic Anhydrase IV/CA4 Antibody (H00000762-M08).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Carbonic Anhydrase IV/CA4 Antibody (H00000762-M08) (0)

There are no reviews for Carbonic Anhydrase IV/CA4 Antibody (H00000762-M08). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Carbonic Anhydrase IV/CA4 Antibody (H00000762-M08) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Carbonic Anhydrase IV/CA4 Products

Bioinformatics Tool for Carbonic Anhydrase IV/CA4 Antibody (H00000762-M08)

Discover related pathways, diseases and genes to Carbonic Anhydrase IV/CA4 Antibody (H00000762-M08). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Carbonic Anhydrase IV/CA4 Antibody (H00000762-M08)

Discover more about diseases related to Carbonic Anhydrase IV/CA4 Antibody (H00000762-M08).
 

Pathways for Carbonic Anhydrase IV/CA4 Antibody (H00000762-M08)

View related products by pathway.

PTMs for Carbonic Anhydrase IV/CA4 Antibody (H00000762-M08)

Learn more about PTMs related to Carbonic Anhydrase IV/CA4 Antibody (H00000762-M08).
 

Research Areas for Carbonic Anhydrase IV/CA4 Antibody (H00000762-M08)

Find related products by research area.

Blogs on Carbonic Anhydrase IV/CA4

There are no specific blogs for Carbonic Anhydrase IV/CA4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Carbonic Anhydrase IV/CA4 Antibody (4G6) and receive a gift card or discount.

Bioinformatics

Gene Symbol CA4
Entrez
Uniprot