Home » Carbonic Anhydrase III/CA3 » Carbonic Anhydrase III/CA3 Antibodies » Carbonic Anhydrase III/CA3 Antibody (4A12-1A3)

Carbonic Anhydrase III/CA3 Antibody (4A12-1A3)

 (5 Publications)
 See All Related
Submit a Review

Images

 
(
Enlarge)
Western Blot: Carbonic Anhydrase III/CA3 Antibody (4A12-1A3) [H00000761-M02] - CA3 monoclonal antibody (M02), clone 4A12-1A3 Analysis of CA3 expression in K-562.
Western Blot: Carbonic Anhydrase III/CA3 Antibody (4A12-1A3) [H00000761-M02] - CA3 monoclonal antibody (M02), clone 4A12-1A3 Analysis of CA3 expression in K-562.
Immunohistochemistry-Paraffin: Carbonic Anhydrase III/CA3 Antibody (4A12-1A3) [H00000761-M02] - Analysis of monoclonal antibody to CA3 on formalin-fixed paraffin-embedded human skeletal muscle. Antibody concentration 3 ...read more
Sandwich ELISA: Carbonic Anhydrase III/CA3 Antibody (4A12-1A3) [H00000761-M02] - Detection limit for recombinant GST tagged CA3 is approximately 1ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, IHC-P
Clone
4A12-1A3
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

Carbonic Anhydrase III/CA3 Antibody (4A12-1A3) Summary

Immunogen
CA3 (AAH04897, 1 a.a. - 260 a.a.) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MAKEWGYASHNGPDHWHELFPNAKGENQSPIELHTKDIRHDPSLQPWSVSYDGGSAKTILNNGKTCRVVFDDTYDRSMLRGGPLPGPYRLRQFHLHWGSSDDHGSEHTVDGVKYAAELHLVHWNPKYNTFKEALKQRDGIAVIGIFLKIGHENGEFQIFLDALDKIKTKGKEAPFTKFDPSCLFPACRDYWTYQGSFTTPPCEECIVWLLLKEPMTVSSDQMAKLRSLLPSAENEPPVPLVSNWRPPQPINNRVVRASFK
Specificity
CA3 - carbonic anhydrase III, muscle specific
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
CA3
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunohistochemistry-Paraffin
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for IHC-P and ELISA.
Publications
Read Publications using H00000761-M02.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Carbonic Anhydrase III/CA3 Antibody (4A12-1A3)

  • CA3
  • CAIII
  • CA-III
  • Car3
  • Carbonate dehydratase III
  • carbonic anhydrase 3
  • Carbonic Anhydrase III
  • carbonic anhydrase III, muscle specific
  • EC 4.2.1.1

Background

Carbonic anhydrase III (CAIII) is a member of a multigene family (at least six separate genes are known) that encode carbonic anhydrase isozymes. These carbonic anhydrases are a class of metalloenzymes that catalyze the reversible hydration of carbon dioxide and are differentially expressed in a number of cell types. The expression of the CA3 gene is strictly tissue specific and present at high levels in skeletal muscle and much lower levels in cardiac and smooth muscle. A proportion of carriers of Duchenne muscle dystrophy have a higher CA3 level than normal. The gene spans 10.3 kb and contains seven exons and six introns.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Carbonic Anhydrase
I/CA1 Antibody
NBP1-88191
Western Blot: Carbonic Anhydrase I/CA1 Antibody [NBP1-88191] - Analysis in human cell line HELA.
Immunohistochemistry-Paraffin: Carbonic Anhydrase I/CA1 Antibody [NBP1-88191] - Staining in human rectum and pancreas tissues using anti-CA1 antibody. Corresponding CA1 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: Carbonic Anhydrase I/CA1 Antibody [NBP1-88191] - Staining of human pancreas shows low expression as expected.
Species: Hu
Applications: WB, IHC, IHC-P
Carbonic Anhydrase
II/CA2 Antibody
NB600-919
Western Blot: Carbonic Anhydrase II/CA2 Antibody [NB600-919] - Lane 1: Carbonic Anhydrase II. Lane 2: None. Load: 50 ng per lane. Primary antibody: Carbonic Anhydrase II primary antibody at 1:1,000 overnight at 4C. Secondary antibody: Peroxidase rabbit secondary antibody at 1:40,000 for 30 min at RT. Blocking: incubated with blocking buffer for 30 min at RT. Predicted/Observed size: 29 kDa, 29 kDa for Carbonic Anhydrase II. Other band(s): None.
Immunohistochemistry: Carbonic Anhydrase II/CA2 Antibody [NB600-919] - Staining in nucleus and cytoplasm of proximal and distal tubules, bowman's capsule and glomerular podocytes of human kidney (B) and in basal cells of retina of a mouse eye (C). Formalin fixed/paraffin embedded sections were subjected to heat induced epitope retrieval (HIER) at pH 6.2 and then incubated with rabbit anti-carbonic anhydrase II antibody at 4.0 ug/ml for 60 minutes. The reaction was developed using either MACH 1 universal HRP polymer detection (human kidney) or MACH 4 universal AP polymer detection system (mouse eye) and visualized with 3'3-diamino-benzidine substrate (DAB) or WARP RED.
Western Blot: Carbonic Anhydrase II/CA2 Antibody [NB600-919] - Detection of Carbonic Anhydrase II in mouse embryonic whole cell lysate. Image provided via product review by verified customer.
(3 Reviews)
(8 Publications)
Species: Hu, Mu
Applications: WB, ELISA, IHC, IHC-Fr, IHC-P
Carbonic Anhydrase
IV/CA4 Antibody (3104 ...
MAB2186
Western blot shows lysates of Jurkat human acute T cell leukemia cell line and human lung tissue. PVDF membrane was probed with 2 µg/mL of Mouse Anti-Human Carbonic Anhydrase IV/CA4 Monoclonal Antibody (Catalog # MAB2186) followed by HRP-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # HAF007). A specific band was detected for Carbonic Anhydrase IV/CA4 at approximately 35 kDa (as indicated). This experiment was conducted under non-reducing conditions and using Immunoblot Buffer Group 1.
(3 Publications)
Species: Hu
Applications: WB, IHC, IP
BDNF [Unconjugated]
248-BD
1 μg/lane of Recombinant Human BDNF was resolved with SDS-PAGE under reducing (R) conditions and visualized by silver staining, showing a single band at 13 kDa.
Recombinant Human BDNF (Catalog #248‑BD) stimulates cell proliferation in the BaF mouse pro-B cell line transfected with TrkB. The ED50 for this effect is 0.2-2 ng/mL.
(6 Reviews)
(106 Publications)
Species: Hu, Mu, Rt, Ca, Eq
GFAP Antibody
NB300-141
Immunocytochemistry/Immunofluorescence: GFAP Antibody [NB300-141] - ICC-IF analysis of mixed neuron-glial cultures using GFAP antibody NB300-141 (red) and Vimentin antibody NB300-223 (green). The fibroblastic cells contain only Vimentin and so are green. The astrocytes contain either Vimentin and GFAP (appearing golden) or predominantly GFAP (appearing red). Blue is nuclear DNA stain.
Immunocytochemistry/Immunofluorescence: GFAP Antibody [NB300-141] - Rat neurons stained with Neurofilament Heavy antibody NB300-217 (red) and GFAP antibody NB300-141 (green).
Immunocytochemistry/Immunofluorescence: GFAP Antibody [NB300-141] - Xenografted mouse brain section : astocyte and human nuclei. Image from a confirmed customer review.
(4 Reviews)
(35 Publications)
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
c-Fos Antibody
NB110-75039
Western Blot: c-Fos Antibody [NB110-75039] - Analysis on marmoset brain lysate prepared in Ripa buffer containing 1% Triton-X100; 1% SDS and 1% SDC. Blocking: 1% LFDM for 30 min at RT; primary antibody dilution 1:2000incubated at 4C overnight.
Immunocytochemistry/Immunofluorescence: c-Fos Antibody [NB110-75039] - Rat trigeminal using Rabbit antibody to cFos: whole serum at a 1:500 dilution.
Immunohistochemistry-Paraffin: c-Fos Antibody [NB110-75039] - IHC on rat brain (paraffin section) using Rabbit antibody to cFos (c-fos): whole serum at 1: 300 dilution incubated overnight at 4C and developed with ABC/DAB/Ni.
(1 Review)
(1 Publication)
Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
Neuropeptide Y
Antibody
NBP1-46535
Neuropeptide Y Antibody
(8 Publications)
Species: Hu, Mu, Rt, Rb, Xp, Ze
Applications: WB, IHC, IHC-Fr, IHC-P

Acetylcholinesterase/A
NBP1-31329
Western Blot: Acetylcholinesterase/ACHE Antibody [NBP1-31329] - Rat tissue extract (50 ug) was separated by 7.5% SDS-PAGE, and the membrane was blotted with AChE antibody diluted at 1:500.
Immunocytochemistry/Immunofluorescence: Acetylcholinesterase/ACHE Antibody [NBP1-31329] - Paraformaldehyde-fixed HeLa, using AChE antibody (Green) at 1:500 dilution. Alpha-tubulin filaments were labeled with an alpha Tubulin antibody (Red) at 1:2500.
Immunohistochemistry-Frozen: Acetylcholinesterase/ACHE Antibody [NBP1-31329] - Frozen sectioned E13.5 Rat brain. Green: AChE protein stained by AChE antibody diluted at 1:250. Red: beta Tubulin 3/ TUJ1, a mature neuron marker, stained by beta Tubulin 3/ TUJ1 antibody [11710] (NBP2-43559) diluted at 1:500. Blue: Fluoroshield with DAPI.
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
GR/NR3C1 Antibody
(BuGR2)
NB300-731
Western Blot: GR/NR3C1 Antibody (BuGR2) [NB300-731] - Analysis of glucocorticoid receptor on mouse liver extract.
Immunocytochemistry/Immunofluorescence: GR/NR3C1 Antibody (BuGR2) [NB300-731] - Analysis of Glucocorticoid Receptor using Glucocorticoid Receptor Monoclonal Antibody (BuGR2) shows staining in U251 Cells. Glucocorticoid Receptor (green), F-Actin staining with Phalloidin (red) and nuclei with DAPI (blue) is shown. Cells were grown on chamber slides and fixed with formaldehyde prior to staining. Cells were probed without (control) or with an antibody recognizing Glucocorticoid Receptor at a dilution of 1:100 over night at 4C, washed with PBS and incubated with a DyLight-488 conjugated.
Flow Cytometry: GR/NR3C1 Antibody (BuGR2) [NB300-731] - Using the Alexa Fluor 647 direct conjugate An intracellular stain was performed on HeLa cells with GR/NR3C1 (BuGR2) antibody NB300-731AF647 (blue) and a matched isotype control NB600-986AF647 (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 2 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Alexa Fluor 647.
(2 Reviews)
(7 Publications)
Species: Hu, Mu, Rt, GP, Rb, Sh, Ye
Applications: WB, ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP, B/N
Glutamine
Synthetase Antibody
NB110-41404
Western Blot: Glutamine Synthetase Antibody [NB110-41404] - Analysis of glutamine synthase. 40ug of lysates from mouse (Lanes M), rat (Lanes R), pig (Lanes P), bovine (Lanes B), or human (Lanes Hu) retina were probed. A 42 kDa band was identified in lysates from retinas of all species.
Immunohistochemistry: Glutamine Synthetase Antibody [NB110-41404] - Localization of glutamine synthase in the retina. Paraffin sections of mouse (A, B), rat (C, D, G-I), or human (E, F) retina fixed in 4% paraformaldehyde were reacted with anti-glutamine synthase (red fluorescence staining in B, D, G, I, and brown immuno-peroxidase reaction [using ABC kit and visualization with DAB product in F]. Nuclei in some immunofluorescence experiments (A-D) were stained with DAPI (shown in cyan), and with nuclear fast red in E and F. On inspection at low magnification, anti- glutamine synthase reacted with a single population of cells extending from the ganglion cell layer (GCL) through the inner nuclear layer (INL). No signal was detected in controls either pre-incubated with 100ug/ml of the immunizing peptide (A) or with pre-immune serum (C, E). The pattern of staining observed in all experiments is typicals. This finding was confirmed by co-localization (indicated by yellow in I) of glutamine synthase (red in G) with antoher marker of glutamine synthase (green in H).
(1 Review)
(4 Publications)
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC
Caspase-3 Antibody
(31A1067) - (Pro and ...
NB100-56708
Western Blot: Caspase-3 Antibody (31A1067) - (Pro and Active) [NB100-56708] - Analysis using the Azide Free version of NB100-56708. Detection of Caspase-3 activation in HeLa cells. Cells were treated with 2mM staurosporine for different time periods. Caspase-3 activation is determined by cleavage of procaspase-3.
Western Blot: Caspase-3 Antibody (31A1067) - (Pro and Active) [NB100-56708] - Western Blot Image of anti-Caspase 3 (31A1067). Whole cell protein from Jurkat cells treated with and without 2 uM staurosporine as indicated was separated on a 4-15% gel by SDS-PAGE, transferred to 0.2 um PVDF membrane and blocked in 5% non-fat milk in TBST. The membrane was probed with 5 ug/ml anti-Caspase 3 in 1% milk, and detected with an anti-mouse HRP secondary antibody using a Femto sensitivity chemiluminescence reagent. Note the detection of both pro-caspase 3 at 35 kDa and the cleaved active caspase 3 at 15-17 kDa.
Western Blot: Caspase-3 Antibody (31A1067) - (Pro and Active) [NB100-56708] - Analysis using the Azide Free version of NB100-56708. Detection of Caspase-3 in multiple human tissues. The tissues shown are A) brain, B) heart, C) intestine, D) kidney, E) liver, F) lung, G) muscle, H) stomach, I) spleen, J) ovary, and K) testis.
(1 Review)
(117 Publications)
Species: Hu, Mu, Rt, Po, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready, KO
GAD1/GAD67 Antibody
NBP1-02161
Immunohistochemistry: GAD1/GAD67 Antibody [NBP1-02161] - Tissue section through an adult mouse brain showing GAD-67 (red staining) in basket cells of the hippocampal formation. Green staining is autofluorescence from green fluorescent protein (GFP) expressed in this transgenic mouse.
Immunohistochemistry: GAD1/GAD67 Antibody [NBP1-02161] - Immunohistochemical staining of mouse hippocampus (2% paraformaldehyde-fixation followed by embedding in paraffin blocks, following standard methods) using NBP1-02161 at a dilution of 1:1000. Red cells represent GAD-expressing inhibitory satellite cells found within the molecular layer of the dentate gyrus.
(1 Publication)
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Calbindin D-28K
Antibody
NBP2-50028
Western Blot: Calbindin D-28K Antibody [NBP2-50028] - Analysis of different tissue lysates and recombinant protein solutions using chicken pAb to calbindin, NBP2-50028, dilution 1:5,000 in green: [1] protein standard (red), [2] rat cerebellum, [3] pig hippocampus, [4] cow cerebellum, [5] protein standard (red). Next lanes are full length recombinant human proteins, [6] Parvalbumin, [7] Calretinin, [8] Calbindin. Bands at 25kDa in tissue lysates and ~30 kDa in protein solutions correspond to calbindin, the recombinant form being slightly larger due to the presence of a His tag and other vector derived sequence. NBP2-50028 antibody specifically recognizes calbindin protein and does not react with the closely related proteins parvalbumin and calretinin.
Immunocytochemistry/Immunofluorescence: Calbindin D-28K Antibody [NBP2-50028] - Cultured mouse embryonic kidney stained with Calbindin antibody (1:200) and DAPI. Image from verified customer review.
Western Blot: Calbindin D-28K Antibody [NBP2-50028] - Analysis of rat brain lysate (left), 0.5 ug of His-tagged recombinant proteins (right) were probed with NBP2-50028 at 1:5,000. Lane 1: Parvalbumin, Lane 2: Calretinin, Lane 3: Calbindin.
(1 Review)
Species: Hu, Mu, Rt, Bv
Applications: WB, ICC/IF, IHC
c-jun [p Ser63]
Antibody (SY0297)
NBP2-67471
Western Blot: c-jun [p Ser63] Antibody (SY0297) [NBP2-67471] - Analysis of Phospho-c-Jun(S63) on different lysates using anti-Phospho-c-Jun(S63) antibody at 1/1,000 dilution. Positive control: Lane 1: NIH/3T3 Lane 2: 293T
Immunocytochemistry/Immunofluorescence: c-jun [p Ser63] Antibody (SY0297) [NBP2-67471] - Staining Phospho-c-Jun(S63) in PC-3M cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Immunohistochemistry-Paraffin: c-jun [p Ser63] Antibody (SY0297) [NBP2-67471] - Analysis of paraffin-embedded human tonsil tissue using anti-Phospho-c-Jun(S63) antibody. Counter stained with hematoxylin.
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Synaptophysin
Antibody
NB300-653
Western Blot: Synaptophysin Antibody [NB300-653] - Approximate MW of Synaptophysin is 39kDa.
Immunohistochemistry-Frozen: Synaptophysin Antibody [NB300-653] - Feline retina. Synaptophysin (green), DAPI (blue). The image was capture by epifluorescent microscopy. Image from verified customer review.
Immunohistochemistry-Paraffin: Synaptophysin Antibody [NB300-653] - Rat brain, 1:100 dilution.
(2 Reviews)
(5 Publications)
Species: Hu, Mu, Rt, Ch, Fe, Mk
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, IP
Somatostatin
Antibody (7G5)
NBP2-37447
Western Blot: Somatostatin Antibody (7G5) [NBP2-37447] - Western blot analysis using SST mAb against human SST recombinant protein. (Expected MW is 38.2 kDa)
Immunohistochemistry: Somatostatin Antibody (7G5) [NBP2-37447] - Paraffin-embedded pancreas tissues, SST mouse mAb with DAB staining.
Flow Cytometry: Somatostatin Antibody (7G5) [NBP2-37447] - Flow cytometric analysis of HepG2 cells using SST mouse mAb (green) and negative control (red).
(1 Review)
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-P, CyTOF-ready, IF
Parvalbumin
Antibody
NB120-11427
Western Blot: Parvalbumin Antibody [NB120-11427] - Analysis of rat cerebellum extract.
Immunocytochemistry/Immunofluorescence: Parvalbumin Antibody [NB120-11427] - Analysis of Parvalbumin using Anti-Parvalbumin Polyclonal Antibody shows staining in U251 Cells. Parvalbumin staining (green), F-Actin staining with Phalloidin (red) and nuclei with DAPI (blue) is shown. Cells were grown on chamber slides and fixed with formaldehyde prior to staining. Cells were probed without (control) or with or an antibody recognizing Parvalbumin at a dilution of 1:200 over night at 4C, washed with PBS and incubated with a DyLight-488 conjugated.
Immunohistochemistry-Paraffin: Parvalbumin Antibody [NB120-11427] - Normal biopsies of deparaffinized Human tonsil tissue.
(5 Publications)
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, IP
GAP-43 Antibody
NB300-143
Western Blot: GAP-43 Antibody [NB300-143] - Different tissue and cell lysates using rabbit pAb to GAP43, dilution 1:20,000 in green: [1] protein standard (red), [2] rat brain, [3] rat spinal cord, [4] mouse brain, [5] mouse spinal cord, [6] SH-SY5Y cells, [7] C6 cells. Single band at 43 kDa mark corresponds to GAP43 protein. The GAP43 protein is detected only in the lysates of neuronal origin. C6 cells are a rat glioma cell line and do not express GAP43 protein
Immunocytochemistry/Immunofluorescence: GAP-43 Antibody [NB300-143] - Cortical neuron-glial cell culture from E20 rat stained with rabbit pAb to GAP43, dilution 1:2,000 in green, and costained with mouse mAb to vimentin, dilution 1:2,000, in red. Blue: DAPI staining of nuclear DNA. GAP43 antibody labels protein expressed in the axonal membrane of neuronal cells, while vimentin antibody stains intermediate filaments in fibroblasts and other non-neuronal cells.
Immunohistochemistry-Paraffin: GAP-43 Antibody [NB300-143] - Review image from confirmed customer on mouse E15.5 paraffin sections.
(1 Review)
(51 Publications)
Species: Hu, Mu, Rt, Po, Bv, Ch, Eq
Applications: WB, ICC/IF, IHC, IHC-P

Publications for Carbonic Anhydrase III/CA3 Antibody (H00000761-M02)(5)


Reviews for Carbonic Anhydrase III/CA3 Antibody (H00000761-M02) (0)

There are no reviews for Carbonic Anhydrase III/CA3 Antibody (H00000761-M02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Carbonic Anhydrase III/CA3 Antibody (H00000761-M02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for Carbonic Anhydrase III/CA3 Antibody (H00000761-M02)

Discover related pathways, diseases and genes to Carbonic Anhydrase III/CA3 Antibody (H00000761-M02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Carbonic Anhydrase III/CA3 Antibody (H00000761-M02)

Discover more about diseases related to Carbonic Anhydrase III/CA3 Antibody (H00000761-M02).
 

Pathways for Carbonic Anhydrase III/CA3 Antibody (H00000761-M02)

View related products by pathway.

PTMs for Carbonic Anhydrase III/CA3 Antibody (H00000761-M02)

Learn more about PTMs related to Carbonic Anhydrase III/CA3 Antibody (H00000761-M02).
 

Research Areas for Carbonic Anhydrase III/CA3 Antibody (H00000761-M02)

Find related products by research area.

Blogs on Carbonic Anhydrase III/CA3

There are no specific blogs for Carbonic Anhydrase III/CA3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Carbonic Anhydrase III/CA3 Antibody (4A12-1A3) and receive a gift card or discount.


Bioinformatics

Gene Symbol CA3
Entrez
OMIM
Uniprot