Home » Carbonic Anhydrase III/CA3 » Carbonic Anhydrase III/CA3 Antibodies » Carbonic Anhydrase III/CA3 Antibody (4A12-1A3)

Carbonic Anhydrase III/CA3 Antibody (4A12-1A3)

 (5 Publications)
 See All Related
Submit a Review

Images

 
(
Enlarge)
Western Blot: Carbonic Anhydrase III/CA3 Antibody (4A12-1A3) [H00000761-M02] - CA3 monoclonal antibody (M02), clone 4A12-1A3 Analysis of CA3 expression in K-562.
Western Blot: Carbonic Anhydrase III/CA3 Antibody (4A12-1A3) [H00000761-M02] - CA3 monoclonal antibody (M02), clone 4A12-1A3 Analysis of CA3 expression in K-562.
Immunohistochemistry-Paraffin: Carbonic Anhydrase III/CA3 Antibody (4A12-1A3) [H00000761-M02] - Analysis of monoclonal antibody to CA3 on formalin-fixed paraffin-embedded human skeletal muscle. Antibody concentration 3 ...read more
Sandwich ELISA: Carbonic Anhydrase III/CA3 Antibody (4A12-1A3) [H00000761-M02] - Detection limit for recombinant GST tagged CA3 is approximately 1ng/ml as a capture antibody.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB, ELISA, Func, IHC, IHC-P, S-ELISA
Clone
4A12-1A3
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

Carbonic Anhydrase III/CA3 Antibody (4A12-1A3) Summary

Immunogen
CA3 (AAH04897, 1 a.a. ~ 260 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MAKEWGYASHNGPDHWHELFPNAKGENQSPIELHTKDIRHDPSLQPWSVSYDGGSAKTILNNGKTCRVVFDDTYDRSMLRGGPLPGPYRLRQFHLHWGSSDDHGSEHTVDGVKYAAELHLVHWNPKYNTFKEALKQRDGIAVIGIFLKIGHENGEFQIFLDALDKIKTKGKEAPFTKFDPSCLFPACRDYWTYQGSFTTPPCEECIVWLLLKEPMTVSSDQMAKLRSLLPSAENEPPVPLVSNWRPPQPINNRVVRASFK
Specificity
CA3 - carbonic anhydrase III, muscle specific
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
CA3
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot 1:500
  • ELISA
  • Functional
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
  • Sandwich ELISA 1:10-1:500
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for IHC-P and ELISA.
Publications
Read Publications using H00000761-M02.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Carbonic Anhydrase III/CA3 Antibody (4A12-1A3)

  • CA3
  • CAIII
  • CA-III
  • Car3
  • Carbonate dehydratase III
  • carbonic anhydrase 3
  • Carbonic Anhydrase III
  • carbonic anhydrase III, muscle specific
  • EC 4.2.1.1

Background

Carbonic anhydrase III (CAIII) is a member of a multigene family (at least six separate genes are known) that encode carbonic anhydrase isozymes. These carbonic anhydrases are a class of metalloenzymes that catalyze the reversible hydration of carbon dioxide and are differentially expressed in a number of cell types. The expression of the CA3 gene is strictly tissue specific and present at high levels in skeletal muscle and much lower levels in cardiac and smooth muscle. A proportion of carriers of Duchenne muscle dystrophy have a higher CA3 level than normal. The gene spans 10.3 kb and contains seven exons and six introns.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Carbonic Anhydrase
I/CA1 Antibody
NBP1-88191
Western Blot: Carbonic Anhydrase I/CA1 Antibody [NBP1-88191] - Analysis in human cell line HELA.
Immunohistochemistry-Paraffin: Carbonic Anhydrase I/CA1 Antibody [NBP1-88191] - Staining of human pancreas shows no positivity in exocrine glandular cells as expected.
Immunohistochemistry-Paraffin: Carbonic Anhydrase I/CA1 Antibody [NBP1-88191] - Analysis in human rectum and pancreas tissues. Corresponding CA1 RNA-seq data are presented for the same tissues.
(3 Publications)
Species: Hu, Rt
Applications: WB, IHC, IHC-P
Carbonic Anhydrase
II/CA2 Antibody
NB600-919
Western Blot: Carbonic Anhydrase II/CA2 Antibody [NB600-919] - Differential expression of CAIX and CAXII in patient-derived tumor grafts. Frozen tissue samples from PDX tumors were homogenized in RIPA buffer containing protease inhibitor. Western blots were probed with antibodies for CAIX, CAXII, CAII, ER, E-cadherin, actin, and GAPDH. Image collected and cropped by CiteAb from the following publication (http://dx.plos.org/10.1371/journal.pone.0199476) licensed under a CC-BY licence.
Immunohistochemistry: Carbonic Anhydrase II/CA2 Antibody [NB600-919] - Staining in nucleus and cytoplasm of proximal and distal tubules, bowman's capsule and glomerular podocytes of human kidney (B) and in basal cells of retina of a mouse eye (C). Formalin fixed/paraffin embedded sections were subjected to heat induced epitope retrieval (HIER) at pH 6.2 and then incubated with rabbit anti-carbonic anhydrase II antibody at 4.0 ug/ml for 60 minutes. The reaction was developed using either MACH 1 universal HRP polymer detection (human kidney) or MACH 4 universal AP polymer detection system (mouse eye) and visualized with 3'3-diamino-benzidine substrate (DAB) or WARP RED.
Western Blot: Carbonic Anhydrase II/CA2 Antibody [NB600-919] - Detection of Carbonic Anhydrase II in mouse embryonic whole cell lysate. Image provided via product review by verified customer.
(3 Reviews)
(8 Publications)
Species: Hu, Mu
Applications: WB, ELISA, IHC, IHC-Fr, IHC-P
Carbonic Anhydrase
IV/CA4 Antibody (3104 ...
MAB2186
Western blot shows lysates of Jurkat human acute T cell leukemia cell line and human lung tissue. PVDF membrane was probed with 2 µg/mL of Mouse Anti-Human Carbonic Anhydrase IV/CA4 Monoclonal Antibody (Catalog # MAB2186) followed by HRP-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # HAF007). A specific band was detected for Carbonic Anhydrase IV/CA4 at approximately 35 kDa (as indicated). This experiment was conducted under non-reducing conditions and using Immunoblot Buffer Group 1.
(4 Publications)
Species: Hu
Applications: WB, IHC, IP
BDNF [HRP]
DBD00
(4 Reviews)
(53 Publications)
Species: Hu
GFAP Antibody
NB300-141
Immunocytochemistry/Immunofluorescence: GFAP Antibody [NB300-141] - Analysis of mixed neuron-glial cultures using GFAP antibody NB300-141 (red) and Vimentin antibody NB300-223 (green). The fibroblastic cells contain only Vimentin and so are green. The astrocytes contain either Vimentin and GFAP (appearing golden) or predominantly GFAP (appearing red). Blue is nuclear DNA stain.
Immunocytochemistry/Immunofluorescence: GFAP Antibody [NB300-141] - Rat neurons stained with Neurofilament Heavy antibody NB300-217 (red) and GFAP antibody NB300-141 (green).
Immunocytochemistry/Immunofluorescence: GFAP Antibody [NB300-141] - Xenografted mouse brain section: astocyte and human nuclei. ICC/IF image submitted by a verified customer review.
(12 Reviews)
(56 Publications)
Species: Hu, Mu, Rt, Po, Bv, Ch, Eq, Gp, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
c-Fos Antibody
(2H2)
NBP2-50037
Knockout Validated: c-Fos Antibody (2H2) [NBP2-50037] - Western blot shows lysates of HeLa human cervical epithelial carcinoma parental cell line and c-Fox knockout (KO) HeLa cell line. PVDF membrane was probed with 1:1000 of Mouse Anti-Human c-Fox Monoclonal Antibody (Catalog # NBP2-50037) followed by HRP-conjugated Anti-Mouse IgG Secondary Antibody (Catalog #HAF018). Specific band was detected for c-Fox at approximately 52 kDa (as indicated) in the parental HeLa cell line, but is not detectable in the knockout HeLa cell line. This experiment was conducted under reducing conditions.
Western Blot: c-Fos Antibody (2H2) [NBP2-50037] - Analysis of cell lysates using mouse c-Fos mAb, dilution 1:1,000 (Green), and rabbit GAPDH pAb, dilution 1:20,000 (Red) used as a loading control. [1] protein standard (red), [2] HeLa cells in serum free media. [3] HeLa cells stimulated with 20% fetal bovine serum for 2hrs after 36hrs in serum free media. [4] rat cortical neurons. [5] rat cortical neurons treated with membrane depolarization buffer for 5hrs. Multiple bands at 50-65kDa in stimulated or treated cell lysates correspond to different forms of the c-Fos proten. The single band at 37 kDa represents GAPDH protein.
Immunocytochemistry/Immunofluorescence: c-Fos Antibody (2H2) [NBP2-50037] - Section of rat hippocampus stained with mouse monoclonal antibody to c-FOS NBP2-50037 in red and counterstained with rabbit polyclonal antibody to FOX3/NeuN. DAPI reveals nuclei of neurons and glia in blue. The hippocampal neurons stain green for FOX3/NeuN and a few also are expressing c-FOS, and so appear orange. These cells were spontaneously active at the time the animal was sacrificed.
(1 Review)
(1 Publication)
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, KO
Neuropeptide Y
Antibody
NBP1-46535
Neuropeptide Y Antibody
(12 Publications)
Species: Hu, Mu, Rt, Rb, Xp, Ze
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IHC-FrFl

Acetylcholinesterase/A
NB100-1519
Western Blot: Acetylcholinesterase/ACHE Antibody [NB100-1519] - Staining of HepG2 (A) and Daudi cell lysates with antibody at 1 ug/mL (B) and HeLa (C) and Jurkat (D) cell lysates with antibody at 0.3 ug/mL (35 ug protein in RIPA buffer). Detected by chemiluminescence.
Immunocytochemistry/Immunofluorescence: Acetylcholinesterase/ACHE Antibody [NB100-1519] - Immunofluorescence analysis of paraformaldehyde fixed U2OS cells, permeabilized with 0.15% Triton. Primary incubation 1hr (10 ug/mL) followed by Alexa Fluor 488 secondary antibody (4 ug/mL), showing cytoplasmic and nuclear/Vesicle staining. The nuclear stain is DAPI (blue). Negative control: Unimmunized goat IgG (10 ug/mL) followed by Alexa Fluor 488 secondary antibody (4 ug/mL).
Flow Cytometry: Acetylcholinesterase/ACHE Antibody [NB100-1519] - Flow cytometric analysis of paraformaldehyde fixed HeLa cells (blue line), permeabilized with 0.5% Triton. Primary incubation 1hr (10 ug/mL) followed by Alexa Fluor 488 secondary antibody (1 ug/mL). IgG control: Unimmunized goat IgG (black line) followed by Alexa Fluor 488 secondary antibody.
(1 Review)
(1 Publication)
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, PEP-ELISA, IHC-FrFl
GR/NR3C1 Antibody
(BuGR2)
NB300-731
Western Blot: GR/NR3C1 Antibody (BuGR2) [NB300-731] - Analysis of glucocorticoid receptor on mouse liver extract.
Immunocytochemistry/Immunofluorescence: GR/NR3C1 Antibody (BuGR2) [NB300-731] - Analysis of Glucocorticoid Receptor using Glucocorticoid Receptor Monoclonal Antibody (BuGR2) shows staining in U251 Cells. Glucocorticoid Receptor (green), F-Actin staining with Phalloidin (red) and nuclei with DAPI (blue) is shown. Cells were grown on chamber slides and fixed with formaldehyde prior to staining. Cells were probed without (control) or with an antibody recognizing Glucocorticoid Receptor at a dilution of 1:100 over night at 4C, washed with PBS and incubated with a DyLight-488 conjugated.
Flow Cytometry: GR/NR3C1 Antibody (BuGR2) [NB300-731] - Using the Alexa Fluor 647 direct conjugate An intracellular stain was performed on HeLa cells with GR/NR3C1 (BuGR2) antibody NB300-731AF647 (blue) and a matched isotype control NB600-986AF647 (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 2 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Alexa Fluor 647.
(3 Reviews)
(11 Publications)
Species: Hu, Mu, Rt, Gp, Rb, Sh, Ye
Applications: WB, ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP, B/N
Glutamine
Synthetase Antibody
NB110-41404
Western Blot: Glutamine Synthetase Antibody [NB110-41404] - Analysis of glutamine synthase. 40ug of lysates from mouse (Lanes M), rat (Lane R), pig (Lane P), bovine (Lane B), or human (Lane Hu) retina were probed. A 42 kDa band was identified in lysates from retinas of all species.
Immunocytochemistry/Immunofluorescence: Glutamine Synthetase Antibody [NB110-41404] - Immunofluorescence using NB110-41404. Submitted via verified customer review.
Immunohistochemistry: Glutamine Synthetase Antibody [NB110-41404] - Localization of glutamine synthase in the retina. Paraffin sections of mouse (A, B), rat (C, D, G-I), or human (E, F) retina fixed in 4% paraformaldehyde were reacted with anti-glutamine synthase (red fluorescence staining in B, D, G, I, and brown immuno-peroxidase reaction. Nuclei in IF experiments (A-D) were stained with DAPI (cyan), and with nuclear fast red in E and F. At low magnification, anti-glutamine synthase reacted with a single population of cells extending from the ganglion cell layer through the inner nuclear layer. No signal was detected in controls either pre-incubated with 100ug/ml of the immunizing peptide (A) or with pre-immune serum (C, E). This finding was confirmed by co-localization (indicated by yellow in I) of glutamine synthase (red in G) with antoher marker of glutamine synthase (green in H).
(1 Review)
(5 Publications)
Species: Hu, Mu, Rt, Bv
Applications: WB, ICC/IF, IHC
Caspase-3 Antibody
(31A1067) - (Pro and ...
NB100-56708
Western Blot: Caspase-3 Antibody (31A1067) - (Pro and Active) [NB100-56708] - Image of Caspase-3 Antibody (31A1067) - (Pro and Active). Whole cell protein from Jurkat cells treated with and without 2 uM staurosporine as indicated was separated on a 4-15% gel by SDS-PAGE, transferred to 0.2 um PVDF membrane and blocked in 5% non-fat milk in TBST. The membrane was probed with 5 ug/ml anti-Caspase 3 in 1% milk, and detected with an anti-mouse HRP secondary antibody using a Femto sensitivity chemiluminescence reagent. Note the detection of both pro-caspase 3 at 35 kDa and the cleaved active caspase 3 at 15-17 kDa.
Immunohistochemistry-Paraffin: Caspase-3 Antibody (31A1067) - (Pro and Active) [NB100-56708] - Tissue section of human spleen using 1:200 dilution of Caspase-3 antibody (clone 31A1067). The staining was developed with HRP labeled anti-mouse IgG secondary antibody and DAB reagent, and nuclei of cells were counter-stained with hematoxylin. This Caspase 3 antibody generated primarily a specific cytoplasmic staining in a subset of spleenocytes with some nuclear signal in a few cells.
Simple Western: Caspase-3 Antibody (31A1067) - (Pro and Active) [NB100-56708] - Simple Western lane view shows a specific band for Caspase-3 Antibody (31A1067) - (Pro and Active) in 0.1 mg/ml of HeLa lysate. This experiment was performed under reducing conditions using the 12-230kDa separation system.
(1 Review)
(153 Publications)
Species: Hu, Mu, Rt, Po, Ch, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, HEStain, IB, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready, IHC-FrFl, KD, KO
GAD1/GAD67 Antibody
NBP1-02161
Immunocytochemistry/Immunofluorescence: GAD1/GAD67 Antibody [NBP1-02161] - Immunocytochemical staining of GAD1/GAD67 (RED/YELLOW) in cultured cortical neurons from a neonatal mouse (C57/Black6). GAD1/GAD67 staining was detected using Texas Red goat anti-chicken IgY. MAP2 staining (GREEN) used a rabbit antibody.
Immunocytochemistry/Immunofluorescence: GAD1/GAD67 Antibody [NBP1-02161] - Sph21 neuroblastoma cells in culture. Fixed with 4% paraformaldehyde. GAD1/GAD67 (GREEN) immunoreactivity. Phalloidin (F-actin) (RED) staining. DAPI (BLUE) staining.
Immunocytochemistry/Immunofluorescence: GAD1/GAD67 Antibody [NBP1-02161] - Immunohistochemical staining of inhibitory neurons (RED) within the hippocampal formation of a transgenic, adult male Black6 mouse brain. The brains were fixed with 4.0% paraformaldehyde. The green staining is low level GFP fluorescence expressed off the actin promoter in this mouse transgenic strain.
(3 Publications)
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
Calbindin D-28K
Antibody
NBP2-50028
Western Blot: Calbindin D-28K Antibody [NBP2-50028] - Analysis of different tissue lysates and recombinant protein solutions using chicken pAb to calbindin, NBP2-50028, dilution 1:5,000 in green: [1] protein standard (red), [2] rat cerebellum, [3] pig hippocampus, [4] cow cerebellum, [5] protein standard (red). Next lanes are full length recombinant human proteins, [6] Parvalbumin, [7] Calretinin, [8] Calbindin. Bands at 25kDa in tissue lysates and ~30 kDa in protein solutions correspond to calbindin, the recombinant form being slightly larger due to the presence of a His tag and other vector derived sequence. NBP2-50028 antibody specifically recognizes calbindin protein and does not react with the closely related proteins parvalbumin and calretinin.
Immunocytochemistry/Immunofluorescence: Calbindin D-28K Antibody [NBP2-50028] - Cultured mouse embryonic kidney stained with Calbindin antibody (1:200) and DAPI. Image from verified customer review.
Immunohistochemistry Free-Floating: Calbindin D-28K Antibody [NBP2-50028] - Analysis of rat cerebellum section stained with chicken Calbindin D-28K pAb, dilution 1:2,000 (Green), and costained with rabbit MeCP2 pAb, dilution 1:5,000 (Red). Following transcardial perfusion with 4% paraformaldehyde, brain was post fixed for 24 hours, cut to 45uM, and free-floating sections were stained with above antibodies. Calbindin D-28K, often used as a Purkinje cell marker, is prominently detected in dendrites and perikarya of these cells in the cerebellar molecular layer. The MeCP2 antibody selectively stains nuclei of neuronal cells.
(1 Review)
(2 Publications)
Species: Hu, Mu, Rt, Bv
Applications: WB, ICC/IF, IHC, IHC-P, IHC-FrFl
c-jun Antibody
(5B1)
NBP2-37576
Western Blot: c-jun Antibody (5B1) [NBP2-37576] - Analysis using c-Jun mouse mAb against NIH/3T3 (1) and Cos7 (2) cell lysate.
Immunocytochemistry/Immunofluorescence: c-jun Antibody (5B1) [NBP2-37576] - Analysis of PC-2 cells using c-Jun mouse mAb (green). Red: Actin filaments have been labeled with Alexa Fluor-555 phalloidin.
Immunohistochemistry-Paraffin: c-jun Antibody (5B1) [NBP2-37576] - Analysis of human rectum cancer tissues using c-Jun mouse mAb with DAB staining.
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
Synaptophysin
Antibody
NB300-653
Western Blot: Synaptophysin Antibody [NB300-653] - Approximate MW of Synaptophysin is 39kDa.
Immunohistochemistry-Frozen: Synaptophysin Antibody [NB300-653] - Feline retina. Synaptophysin (green), DAPI (blue). The image was capture by epifluorescent microscopy. Image from verified customer review.
Immunohistochemistry-Paraffin: Synaptophysin Antibody [NB300-653] - Rat brain, 1:100 dilution.
(2 Reviews)
(6 Publications)
Species: Hu, Mu, Rt, Ch, Fe, Pm
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, IP
Somatostatin
Antibody (7G5)
NBP2-37447
Western Blot: Somatostatin Antibody (7G5) [NBP2-37447] - Analysis using SST mAb against human SST recombinant protein. (Expected MW is 38.2 kDa)
Immunohistochemistry-Paraffin: Somatostatin Antibody (7G5) [NBP2-37447] - Analysis of lung cancer tissues using SST mouse mAb with DAB staining.
Flow Cytometry: Somatostatin Antibody (7G5) [NBP2-37447] - Analysis of HepG2 cells using SST mouse mAb (green) and negative control (red).
(1 Review)
(1 Publication)
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-P, CyTOF-ready, IF
Parvalbumin
Antibody
NB120-11427
Western Blot: Parvalbumin Antibody [NB120-11427] - WB analysis of rat cerebellum extract.
Immunocytochemistry/Immunofluorescence: Parvalbumin Antibody [NB120-11427] - Analysis of Parvalbumin using anti-Parvalbumin polyclonal antibody shows staining in U251 Cells. Parvalbumin staining (green), F-Actin staining with Phalloidin (red) and nuclei with DAPI (blue) is shown. Cells were grown on chamber slides and fixed with formaldehyde prior to staining. Cells were probed without (control) or with or an antibody recognizing Parvalbumin at a dilution of 1:200 overnight at 4C, washed with PBS and incubated with a DyLight-488 conjugated.
Immunohistochemistry-Paraffin: Parvalbumin Antibody [NB120-11427] - Stargazin expression is restricted to PV+ interneurons in WT mouse somatosensory cortex (upper row). Somatodendritic stargazin immunoreactivity is lost in PV+ interneurons in stargazer mouse (lower row). Co-labeling of stargazin and parvalbumin antibodies shown in layer 2/3 at 63x magnification (scale = 10 um). Image collected and cropped by CiteAb from the following publication (http://journal.frontiersin.org/article/10.3389/fncel.2013.00156/abstract), licensed under a CC-BY licence.
(10 Publications)
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, IP
GAP-43 Antibody
NB300-143
Western Blot: GAP-43 Antibody [NB300-143] - Different tissue and cell lysates using rabbit pAb to GAP43, dilution 1:20,000 in green: [1] protein standard (red), [2] rat brain, [3] rat spinal cord, [4] mouse brain, [5] mouse spinal cord, [6] SH-SY5Y cells, [7] C6 cells. Single band at 43 kDa mark corresponds to GAP43 protein. The GAP43 protein is detected only in the lysates of neuronal origin. C6 cells are a rat glioma cell line and do not express GAP43 protein
Immunocytochemistry/Immunofluorescence: GAP-43 Antibody [NB300-143] - Cortical neuron-glial cell culture from E20 rat stained with rabbit pAb to GAP43, dilution 1:2,000 in green, and costained with mouse mAb to vimentin, dilution 1:2,000, in red. Blue: DAPI staining of nuclear DNA. GAP43 antibody labels protein expressed in the axonal membrane of neuronal cells, while vimentin antibody stains intermediate filaments in fibroblasts and other non-neuronal cells.
Immunohistochemistry-Paraffin: GAP-43 Antibody [NB300-143] - Posterior MOE sections at approximately the same region where EOG was recorded were obtained from control and Skn-1a-/- mice exposed to either water or chemicals for 2 wks. The sections were immunoreacted with antibodies against GAP43 and OMP and stained with DAPI. Confocal images were taken from olfactory turbinate II. Similar morphology and marker expression were found in four groups of mice, indicating there was no obvious tissue damage in both control and Skn-1a-/- mice after chemical exposure in the posterior MOE regions where EOG recordings were performed. Scale bar: 50 um. Image collected and cropped by CiteAb from the following publication (http://eneuro.sfn.org/lookup/doi/10.1523/ENEURO.0135-17.2017), licensed under a CC-BY licence.
(1 Review)
(70 Publications)
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, Dr, Eq, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P

Publications for Carbonic Anhydrase III/CA3 Antibody (H00000761-M02)(5)


Reviews for Carbonic Anhydrase III/CA3 Antibody (H00000761-M02) (0)

There are no reviews for Carbonic Anhydrase III/CA3 Antibody (H00000761-M02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Carbonic Anhydrase III/CA3 Antibody (H00000761-M02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Learn about Custom Antibody Labeling

Additional Carbonic Anhydrase III/CA3 Products

Bioinformatics Tool for Carbonic Anhydrase III/CA3 Antibody (H00000761-M02)

Discover related pathways, diseases and genes to Carbonic Anhydrase III/CA3 Antibody (H00000761-M02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Carbonic Anhydrase III/CA3 Antibody (H00000761-M02)

Discover more about diseases related to Carbonic Anhydrase III/CA3 Antibody (H00000761-M02).
 

Pathways for Carbonic Anhydrase III/CA3 Antibody (H00000761-M02)

View related products by pathway.

PTMs for Carbonic Anhydrase III/CA3 Antibody (H00000761-M02)

Learn more about PTMs related to Carbonic Anhydrase III/CA3 Antibody (H00000761-M02).
 

Research Areas for Carbonic Anhydrase III/CA3 Antibody (H00000761-M02)

Find related products by research area.

Blogs on Carbonic Anhydrase III/CA3

There are no specific blogs for Carbonic Anhydrase III/CA3, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Carbonic Anhydrase III/CA3 Antibody (4A12-1A3) and receive a gift card or discount.


Bioinformatics

Gene Symbol CA3
Entrez
OMIM
Uniprot