Carbonic Anhydrase III/CA3 Antibody (4A12-1A3)

Images

 
Western Blot: Carbonic Anhydrase III/CA3 Antibody (4A12-1A3) [H00000761-M02] - CA3 monoclonal antibody (M02), clone 4A12-1A3 Analysis of CA3 expression in K-562.
Immunohistochemistry-Paraffin: Carbonic Anhydrase III/CA3 Antibody (4A12-1A3) [H00000761-M02] - Analysis of monoclonal antibody to CA3 on formalin-fixed paraffin-embedded human skeletal muscle. Antibody concentration 3 ...read more
Sandwich ELISA: Carbonic Anhydrase III/CA3 Antibody (4A12-1A3) [H00000761-M02] - Detection limit for recombinant GST tagged CA3 is approximately 1ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, IHC-P
Clone
4A12-1A3
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Carbonic Anhydrase III/CA3 Antibody (4A12-1A3) Summary

Immunogen
CA3 (AAH04897, 1 a.a. - 260 a.a.) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MAKEWGYASHNGPDHWHELFPNAKGENQSPIELHTKDIRHDPSLQPWSVSYDGGSAKTILNNGKTCRVVFDDTYDRSMLRGGPLPGPYRLRQFHLHWGSSDDHGSEHTVDGVKYAAELHLVHWNPKYNTFKEALKQRDGIAVIGIFLKIGHENGEFQIFLDALDKIKTKGKEAPFTKFDPSCLFPACRDYWTYQGSFTTPPCEECIVWLLLKEPMTVSSDQMAKLRSLLPSAENEPPVPLVSNWRPPQPINNRVVRASFK
Specificity
CA3 - carbonic anhydrase III, muscle specific
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
CA3
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunohistochemistry-Paraffin
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for IHC-P and ELISA.
Publications
Read Publications using H00000761-M02.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Carbonic Anhydrase III/CA3 Antibody (4A12-1A3)

  • CA3
  • CAIII
  • CA-III
  • Car3
  • Carbonate dehydratase III
  • carbonic anhydrase 3
  • Carbonic Anhydrase III
  • carbonic anhydrase III, muscle specific
  • EC 4.2.1.1

Background

Carbonic anhydrase III (CAIII) is a member of a multigene family (at least six separate genes are known) that encode carbonic anhydrase isozymes. These carbonic anhydrases are a class of metalloenzymes that catalyze the reversible hydration of carbon dioxide and are differentially expressed in a number of cell types. The expression of the CA3 gene is strictly tissue specific and present at high levels in skeletal muscle and much lower levels in cardiac and smooth muscle. A proportion of carriers of Duchenne muscle dystrophy have a higher CA3 level than normal. The gene spans 10.3 kb and contains seven exons and six introns.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF2180
Species: Hu
Applications: WB, Simple Western, IP
NB600-919
Species: Hu, Mu
Applications: WB, ELISA, IHC, IHC-Fr, IHC-P
MAB2186
Species: Hu
Applications: WB, IHC, IP
248-BD/CF
Species: Hu, Mu, Rt, Ca, Eq
NB300-141
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, Fe, GP, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-50037
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF
NBP1-46535
Species: Hu, Mu, Rt, Rb, Xp, Ze
Applications: WB, IHC, IHC-Fr, IHC-P
NBP2-22449
Species: Hu, Mu, Rt, Fe, GP, Rb
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, GS
NB300-731
Species: Hu, Mu, Rt, GP, Rb, Sh, Ye
Applications: WB, ChIP, B/N, Flow, GS, ICC/IF, IHC, IHC-P, IP
NB110-41404
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC
NB100-56708
Species: Hu, Mu, Rt, Po, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready
AF2086
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC
NBP2-50048
Species: Hu, Mu, Rt, Po, Bv, Ch, Eq
Applications: WB, ICC/IF
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
NB300-653
Species: Hu, Mu, Rt, Ch, Mk
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
MAB2358
Species: Hu, Mu
Applications: IHC, ICC
NB120-11427
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NB300-143
Species: Hu, Mu, Rt, Po, Ca, Ch, Pm
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P

Publications for Carbonic Anhydrase III/CA3 Antibody (H00000761-M02)(5)

Reviews for Carbonic Anhydrase III/CA3 Antibody (H00000761-M02) (0)

There are no reviews for Carbonic Anhydrase III/CA3 Antibody (H00000761-M02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Carbonic Anhydrase III/CA3 Antibody (H00000761-M02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Carbonic Anhydrase III/CA3 Products

Bioinformatics Tool for Carbonic Anhydrase III/CA3 Antibody (H00000761-M02)

Discover related pathways, diseases and genes to Carbonic Anhydrase III/CA3 Antibody (H00000761-M02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Carbonic Anhydrase III/CA3 Antibody (H00000761-M02)

Discover more about diseases related to Carbonic Anhydrase III/CA3 Antibody (H00000761-M02).
 

Pathways for Carbonic Anhydrase III/CA3 Antibody (H00000761-M02)

View related products by pathway.

PTMs for Carbonic Anhydrase III/CA3 Antibody (H00000761-M02)

Learn more about PTMs related to Carbonic Anhydrase III/CA3 Antibody (H00000761-M02).
 

Research Areas for Carbonic Anhydrase III/CA3 Antibody (H00000761-M02)

Find related products by research area.

Blogs on Carbonic Anhydrase III/CA3

There are no specific blogs for Carbonic Anhydrase III/CA3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Carbonic Anhydrase III/CA3 Antibody (4A12-1A3) and receive a gift card or discount.

Bioinformatics

Gene Symbol CA3
Entrez
OMIM
Uniprot