CAPSL Antibody


Immunocytochemistry/ Immunofluorescence: CAPSL Antibody [NBP2-32387] - Staining of human cell line U-2 OS shows localization to nucleus and microtubules.
Immunohistochemistry-Paraffin: CAPSL Antibody [NBP2-32387] - Staining in human fallopian tube and prostate tissues using anti-CAPSL antibody. Corresponding CAPSL RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: CAPSL Antibody [NBP2-32387] - Staining of human fallopian tube shows distinct positivity in cytoplasm and cilia in subsets of glandular cells.
Immunohistochemistry-Paraffin: CAPSL Antibody [NBP2-32387] - Staining of human fallopian tube shows high expression.
Immunohistochemistry-Paraffin: CAPSL Antibody [NBP2-32387] - Staining of human prostate shows low expression as expected.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P

Order Details

CAPSL Antibody Summary

This antibody was developed against a recombinant protein corresponding to amino acids: PMSRARKEVIMQAFRKLDKTGDGVITIEDLREVYNAKHHPKYQNGEWSEEQ
Specificity of human CAPSL antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (96%), Rat (96%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
CAPSL Protein (NBP2-32387PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for CAPSL Antibody

  • calcyphosine-like
  • calcyphosin-like protein
  • MGC26610


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu
Applications: WB, IHC, IHC-P, PEP-ELISA
Species: Mu
Applications: WB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
Species: Hu
Applications: WB, IHC
Species: Hu
Applications: Flow, Func, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu, Rt
Applications: WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Rt
Applications: B/N, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
Species: Hu
Applications: WB, ELISA
Species: Hu
Applications: Flow, CyTOF-ready
Species: Hu
Applications: ICC/IF, IHC-P, PAGE
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IP
Species: Hu
Applications: WB, IHC, IP, DirELISA
Species: Hu
Applications: WB, ICC
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: WB, Flow, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for CAPSL Antibody (NBP2-32387) (0)

There are no publications for CAPSL Antibody (NBP2-32387).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CAPSL Antibody (NBP2-32387) (0)

There are no reviews for CAPSL Antibody (NBP2-32387). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for CAPSL Antibody (NBP2-32387) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional CAPSL Products

Bioinformatics Tool for CAPSL Antibody (NBP2-32387)

Discover related pathways, diseases and genes to CAPSL Antibody (NBP2-32387). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CAPSL Antibody (NBP2-32387)

Discover more about diseases related to CAPSL Antibody (NBP2-32387).

Blogs on CAPSL

There are no specific blogs for CAPSL, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our CAPSL Antibody and receive a gift card or discount.


Gene Symbol CAPSL