CAPSL Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: CAPSL Antibody [NBP2-32387] - Staining of human cell line U-2 OS shows localization to nucleus & microtubules.
Immunohistochemistry-Paraffin: CAPSL Antibody [NBP2-32387] - Staining of human fallopian tube shows distinct positivity in cytoplasm and cilia in subsets of glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CAPSL Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: PMSRARKEVIMQAFRKLDKTGDGVITIEDLREVYNAKHHPKYQNGEWSEEQ
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (96%), Rat (96%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CAPSL
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
CAPSL Protein (NBP2-32387PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for CAPSL Antibody

  • calcyphosine-like
  • calcyphosin-like protein
  • MGC26610

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB110-1244
Species: Hu, Mu
Applications: WB, IHC, IHC-P, PEP-ELISA
AF3465
Species: Mu
Applications: WB
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
MAB3428
Species: Hu
Applications: WB, IHC
DDX0131P-100
Species: Hu
Applications: Flow, Func, ICC/IF, IHC, IHC-Fr, IHC-P
MAB1930
Species: Hu, Mu, Rt
Applications: WB
NBP1-87714
Species: Hu
Applications: ICC/IF, IHC, IHC-P
MAB666
Species: Hu
Applications: WB, Flow, CyTOF-ready, Neut
NB120-6405
Species: Rt
Applications: B/N, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
MAB6534
Species: Hu
Applications: WB, ELISA
AF3126
Species: Hu
Applications: Flow, CyTOF-ready
NBP2-53380
Species: Hu
Applications: ICC/IF, IHC-P, PAGE
NBP2-34294
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC-P
NBP2-34073
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
PP-H4537-00
Species: Hu
Applications: WB, IHC, IP, DirELISA
AF2614
Species: Hu
Applications: WB, ICC
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NB100-39002
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP2-29942
Species: Hu
Applications: WB, Flow, IHC-P
NBP1-83122
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for CAPSL Antibody (NBP2-32387) (0)

There are no publications for CAPSL Antibody (NBP2-32387).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CAPSL Antibody (NBP2-32387) (0)

There are no reviews for CAPSL Antibody (NBP2-32387). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for CAPSL Antibody (NBP2-32387) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CAPSL Products

Bioinformatics Tool for CAPSL Antibody (NBP2-32387)

Discover related pathways, diseases and genes to CAPSL Antibody (NBP2-32387). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CAPSL Antibody (NBP2-32387)

Discover more about diseases related to CAPSL Antibody (NBP2-32387).

Blogs on CAPSL

There are no specific blogs for CAPSL, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CAPSL Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CAPSL