CAP1 Antibody - BSA Free

Western Blot: CAP1 Antibody [NBP1-58320] - THP-1 cell lysate, concentration 0.2-1 ug/ml.

Immunohistochemistry: CAP1 Antibody [NBP1-58320] - Formalin Fixed Paraffin Embedded Tissue: Human heart Tissue Observed Staining: Plasma membrane Primary Antibody Concentration: N/A Other Working Concentrations: 1:600 Secondary Antibody: Donkey anti-Rabbit-Cy3 Secondary Antibody Concentration: 1:200 Magnification: 20X Exposure Time: 0.5 - 2.0 sec

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

CAP1 Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to CAP1(CAP, adenylate cyclase-associated protein 1 (yeast)) The peptide sequence was selected from the middle region of CAP1. Peptide sequence KAQSGPVRSGPKPFSAPKPQTSPSPKRATKKEPAVLELEGKKWRVENQEN. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CAP1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for CAP1 Antibody - BSA Free

• adenylyl cyclase-associated protein 1
• CAP, adenylate cyclase-associated protein 1 (yeast)
• CAP1
• CAP1-PEN
• CAPCAP 1
• SSKAP55

Background

The protein encoded by this gene is related to the S. cerevisiae CAP protein, which is involved in the cyclic AMP pathway. The human protein is able to interact with other molecules of the same protein, as well as with CAP2 and actin. Alternatively splice

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for CAP1 Antibody (NBP1-58320)(1)

Publication using NBP1-58320

• Huang X, Chao R, Zhang Y, et al. CAP1, a target of miR-144/451, negatively regulates erythroid differentiation and enucleation Journal of cellular and molecular medicine 2021-01-26 [PMID: 33496386] (WB)

Bioinformatics

• Gene Symbol: CAP1
• Uniprot:
  • Q01518()